Property Summary

NCBI Gene PubMed Count 34
PubMed Score 32.66
PubTator Score 28.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.200 2.3e-02
Breast cancer -2.400 6.5e-05
cystic fibrosis -2.365 4.3e-07
Endometriosis -1.055 3.0e-02
glioblastoma -1.700 6.4e-03
lung adenocarcinoma -1.500 1.1e-13
lung carcinoma -1.300 9.8e-13
medulloblastoma, large-cell -2.700 2.5e-04
non-small cell lung cancer -2.567 5.8e-19
ovarian cancer -2.300 8.8e-04
pituitary cancer -1.400 2.2e-03
psoriasis -1.500 9.4e-08
spina bifida -1.847 3.2e-02

 IMPC Phenotype (1)

Gene RIF (22)

AA Sequence

MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDL      1 - 70
TCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPA     71 - 140
AMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTENP    141 - 210
YSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPV    211 - 280
KAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEA    281 - 350
SGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC    351 - 420
PCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWE    421 - 490
WEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIF    491 - 560
RGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKLIVNMKSFVQHWKPSLGRKVMDILKRECK      561 - 628
//

Text Mined References (35)

PMID Year Title