Property Summary

NCBI Gene PubMed Count 100
PubMed Score 451.35
PubTator Score 208.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 2.000 1.0e-03
ependymoma 2.100 8.6e-03
oligodendroglioma 1.700 2.6e-03
glioblastoma multiforme 2.000 6.9e-22
atypical teratoid / rhabdoid tumor 2.100 7.3e-03
primitive neuroectodermal tumor 2.300 2.1e-02
pancreatic ductal adenocarcinoma liver m... -1.349 2.4e-03
pediatric high grade glioma 1.700 1.8e-03
pilocytic astrocytoma 3.300 6.8e-11
sonic hedgehog group medulloblastoma 2.200 1.8e-04
psoriasis -1.200 1.5e-31

Gene RIF (84)

PMID Text
27031829 Netrin-1 enhanced infectivity of hepatitis C virus particles and promoted viral entry by increasing the activation and decreasing the recycling of the epidermal growth factor receptor (EGFR), a protein that is dysregulated in hepatocellular carcinoma.
26859457 identify the V-2 domain of netrin-1 to be important for its interaction with the Ig1/Ig2 domains of UNC5H2
26573873 Akt-FoxO1 signaling pathway plays an essential role during liver regeneration
26393880 MUC4 has a role in promoting neural invasion mediated by the axon guidance factor Netrin-1 in pancreatic ductal adenocarcinoma
26039999 Netrin-1 stimulates phosphatase 1A to dephosphorylate YAP, which leads to decreased ubiquitination and degradation, enhancing YAP accumulation and signaling
25950802 NTN1-DCC pathway contains targets of FDA-approved drugs and may offer promise for guiding applied clinical research on preventive and therapeutic interventions for AMD
25903786 results demonstrate that netrin 1 is an important regulator of blood-brain barrier maintenance that protects the central nervous system against inflammatory conditions such as multiple sclerosis.
25569157 Investigation of the mechanisms that trigger local translation revealed a role for calcium-dependent retrograde netrin-1/DCC receptor signaling.
25483983 These results identify Netrin-1 as a key regulator of osteoclast differentiation that may be a new target for bone therapies.
25353184 Careful phenotyping of patients combined with molecular and functional studies in zebrafish identifed netrin-1 as a potential shared genetic factor for cardiac and thyroid congenital defects.
25289643 These studies demonstrate that semaphorin 3A and netrin-1 can be useful early diagnostic biomarkers of AKI after liver transplantation.
25154466 early urinary biomarker in the diagnosis of septic acute kidney injury
25022751 results of another in vitro assay, in which endothelial cells were co-cultured with human fibroblasts, however, showed that Mel2a-netrin1 CM inhibited tube formation through blocking elongation and coalescence of human umbilical vein endothelial cells
25001177 netrin-1 promoted pancreatic cancer cell proliferation by upregulation of murine double minute 2 (Mdm2).
24827071 Netrin-1 ameliorates myocardial infarction-induced myocardial injury.
24812271 Netrin-1 promotes medulloblastoma cell invasiveness and angiogenesis, and demonstrates elevated expression in tumor tissue and urine of patients with pediatric medulloblastoma.
24778312 novel model for the spatial regulation of axon branching by Netrin-1, in which localized plasma membrane expansion occurs via TRIM9-dependent regulation of SNARE-mediated vesicle fusion.
24738865 Ntn-1 induces MMP-12-dependent E-cad degradation via the distinct activation of PKCalpha and FAK/Fyn, which is necessary to govern the activation of ERK, JNK, and NF-KB in promoting motility of umbilical cord blood-derived mesenchymal stem cells.
24716747 Increased maternal netrin-4 levels in IUGR neonates may reflect in utero hypoxia, while the negative correlations between fetal netrin-1 and -4 levels may exert the dynamic balance between their angio- and anti-angiogenic properties.
24647424 Data indicate both total and nuclear netrin-1 expression as prognostic factors in brain metastases patients in contrast to other prognostic markers in oncology such as patient age, number of brain metastases or Ki67 proliferation index.
24584118 Netrin-1 is highly expressed in obese but not lean adipose tissue, where it directs the retention of macrophages, promoting inflammation. NTN1 also promotes insulin resistance.
24528886 In bladder cancer cells, netrin-1 expression is increased compared to control cells.
24442237 These results suggest that in hypoxic HCC cells, netrin-1 activates downstream signaling pathways to induce EMT activation with subsequent production of multiple inflammatory mediators which in turn promotes cancer invasion.
24338005 Studies indicate that elevating netrin-1 expression increased migration and invasion in colorectal cancer cells.
24293316 The netrin-1 upregulation which appears to be p53-dependent is a survival mechanism as netrin-1 silencing by siRNA is associated with a potentiation of cancer cell death upon Doxorubicin treatment.
24262644 promotes angiogenesis and accelerates atherosclerosis, protects the heart against ischemia-reperfusion injury, and reduces the infarct size.
24174661 Netrin-1 increases the frequency and amplitude of excitatory postsynaptic p otentials (EPSPs) recorded from cortical pyramidal neurons.
24122613 Data indicate that dysregulation of expression of netrin-1 NTN1 in smooth muscle cell (SMC) and its chemorepulsive receptor UNC5B in macrophages are involved in the development of atherosclerosis and unstable plaques.
24092381 Tubular atrophy and low netrin-1 gene expression are associated with delayed kidney allograft function.
23666553 Higher netrin-1 and lower UNC5B expression in all prostate carcinoma cell lines indicated that netrin-1 and UNC5B could be used to predict metastasis.
23549787 netrin-1 forms a complex with both Notch2 and Jagged1.
23538444 Netrin-1 protects hypoxia-induced mitochondrial apoptosis through HSP27 expression via DCC- and integrin alpha6beta4-dependent Akt, GSK-3beta, and HSF-1 in mesenchymal stem cells.
23526078 Netrin-1 was upregulated in kidney carcinoma.
23512105 In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample.
23195957 Netrin-1 promotes glioblastoma cell invasiveness and angiogenesis by multiple pathways including activation of RhoA, cathepsin B, and cAMP-response element-binding protein
22889408 There was no relationship between the basal netrin-1 and decline in netrin-1 concentrations and the progression-free survival and overall survival in gastric cancer.
22871610 Data indicate that DeltaN-netrin-1 stimulated cell proliferation in vitro and tumor growth in vivo.
22779713 Netrin 1 gene mutation found in patients diagnosed with superior semicircular canal dehiscence syndrome.
22685302 knockdown of DSCAM inhibits netrin-induced tyrosine phosphorylation of UNC5C and Fyn as well as the interaction of UNC5C with Fyn. The double knockdown of both receptors abolishes the induction of Fyn tyrosine phosphorylation by netrin-1
22588384 Netrin-1 and DCC are increased in diseased lumbar intervertebral discs and may play a role in the process of neurovascular growth.
22332546 netrin-1 protein expression may be related to tumorigenesis and tumor progression of gastric cancer.
22252496 Hypoxia-inducible factor 1 controls the expression of the uncoordinated-5-B receptor, but not of netrin-1, in first trimester human placenta
22231519 It was shown that netrin-1 was secreted by macrophages in human and mouse atheroma, where it inactivated macrophage migration out of atherosclerotic plaques.
21980448 an autocrine function for netrin-1 and netrin-3 in U87 and U373 cells that slows migration
21789787 overexpression is predictive of ovarian malignancies
21740336 Properties and perspectives of uNGAL and Netrin-1 for their appropriate clinical utilization.
21733374 Gene silencing of netrin-1 could inhibit viability, proliferation, migration, and tubal formation of HUVECs, and placental angiogenesis.
21505994 Netrin-1 enhanced the viability, migration and tube formation of human placental microvascular endothelial cells.
21303223 Plasma netrin-1 can be used as diagnostic biomarker of many human cancers.
21193949 Netrin-1 may regulate the development of placental vessels and plays a key role in the pathogenesis of fetal growth restriction.
20620466 Urinary netrin-1 levels are increased in patients with various forms of acute kidney injury, and may therefore serve as a biomarker.
20609112 our findings might indicate also an important role for DCC and netrin-1 in human foetal central nervous system development
20305387 Data propose that induction of netrin-1 expression via NFkappaB in inflammatory bowel diseases patients could affect colorectal tumor promotion and progression
20080097 Netrin-1 might be an important regulator of pancreatic tumor growth that functions in tumor and endothelial cells.
20075388 Pulmonary netrin-1 levels are repressed during acute lung injury.
20036673 Netrin-1 has a role in cardioprotection
20029409 Observational study of gene-disease association. (HuGE Navigator)
20007677 Netrin-1 is an early, predictive biomarker of acute kidney injury after cardiopulmnoary bypass.
19940358 Study suggests that Netrin-1 promotes melanoma cell invasion and migration and therefore has an important role in the progression of malignant melanoma.
19826074 Netrin-1 protein functions might vary with its localization in the placenta and probably with time of gestation.
19822088 Netrin-1 inhibited migration of synovial fibroblasts from patients with rheumatoid arthritis and osteoarthitis.
19349462 Netrin-1 up-regulation is a potential marker for poor prognosis in stage 4 neueroblastoma in infants.
19211441 High levels of netrin-1 found in 43 of the 92 NSCLC tumor samples. Interference with netrin-1 in human lung cancer cell lines was associated with UNC5H-mediated cell death in vitro and with tumor growth inhibition and/or regression in xenografted mice.
19122655 HIF-1alpha-dependent induction of netrin-1 attenuates hypoxia-elicited inflammation at mucosal surfaces
18922894 the transcriptionally active TAp73alpha tumor suppressor is implicated in the apoptosis induced by netrin-1 in a p53-independent and DCC/ubiquitin-proteasome dependent manner.
18854154 Knockdown of netrin 1 (NTN1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18796601 netrin-1 is not only an attractive cue for developing commissural axons but also promotes their survival
18692059 NF-kappaB activation that occurs in response to inflammation confers a selective advantage for tumor development through NF-kappaB-mediated netrin-1 up-regulation
18653556 Netrin 1, through its receptor DCC, inhibits RhoA in embryonic spinal commissural neurons.
18469807 PIKE-L acts as a downstream survival effector for netrin-1 through UNC5B in the nervous system
18455953 In adults, decreased expression within the spinal cord injury lesion; likely an inhibitor of regenerating neural progenitors
18439993 Data show that Netrin-1 expressing cells inhibited angiogenic sprouting of unc5b expressing blood vessels, but had no pro-angiogenic activity at any stage of development examined.
18400890 Although cAMP can alter response of axons to netrin-1, we conclude that netrin-1 does not alter cAMP levels in axons attracted by this cue and that soluble adenyl cyclase is not required for axon attraction to netrin-1.
18353983 Netrin-1 expression observed in a large fraction of human metastatic breast tumors confers a selective advantage for tumor cell survival.
18253061 Both deleted in colorectal cancer (DCC) and neogenin become tyrosine phosphorylated in cortical neurons in response to netrin-1.
16203981 Endothelial expression of netrin-1 may inhibit basal cell migration into tissues and its down-regulation with the onset of sepsis/inflammation may facilitate leukocyte recruitment.
16181408 Ligand-mediated down-regulation of deleted in colorectal cancer might participate in loss of netrin-responsiveness in developing nervous system.
16158190 Review suggests possible roles of netrin-1 in nervous system development, neovascularisation, adhesion and tumorigenesis.
15811950 Raft localization of DCC is required for netrin-1-induced DCC-dependent ERK activation, and netrin-1-mediated axon outgrowth requires lipid raft integrity.
15574733 Netrin binds through multiple domains to both DCC and Unc5c.
15573119 Binding of netrin-1 to its receptors inhibits tumour suppressor p53-dependent apoptosis (review)
15491747 DCC/netrin-1 signaling may commit cells to the transition of endometrial gland architecture or function from a proliferating to a secretory phase.
14602071 Data demonstrate that alpha6beta4 integrin mediates pancreatic epithelial cell adhesion to Netrin-1, whereas recruitment of alpha6beta4 and alpha3beta1 regulate the migration of putative pancreatic progenitors on Netrin-1.
12810718 Netrin binds discrete subdomains of DCC and UNC5 and mediates interactions between DCC and heparin

AA Sequence

MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTC      1 - 70
GRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGK     71 - 140
KFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHTDM    141 - 210
RPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQ    211 - 280
VGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRC    281 - 350
RFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT    351 - 420
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKY    421 - 490
CKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGN    491 - 560
AEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA                              561 - 604
//

Text Mined References (101)

PMID Year Title
27031829 2016 Epidermal Growth Factor Receptor-Dependent Mutual Amplification between Netrin-1 and the Hepatitis C Virus.
26859457 2016 Structural Decoding of the Netrin-1/UNC5 Interaction and its Therapeutical Implications in Cancers.
26573873 2016 The neuroimmune guidance cue netrin-1 controls resolution programs and promotes liver regeneration.
26393880 2015 MUC4-promoted neural invasion is mediated by the axon guidance factor Netrin-1 in PDAC.
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
26039999 2015 Netrin-1 exerts oncogenic activities through enhancing Yes-associated protein stability.
25950802 2015 Netrin-1 - DCC Signaling Systems and Age-Related Macular Degeneration.
25903786 2015 Netrin 1 regulates blood-brain barrier function and neuroinflammation.
25569157 2015 Neuron-wide RNA transport combines with netrin-mediated local translation to spatially regulate the synaptic proteome.
25483983 2015 Netrin-1 is a critical autocrine/paracrine factor for osteoclast differentiation.
25353184 2015 Functional zebrafish studies based on human genotyping point to netrin-1 as a link between aberrant cardiovascular development and thyroid dysgenesis.
25289643 2014 Netrin-1 and semaphorin 3A predict the development of acute kidney injury in liver transplant patients.
25154466 2014 Urinary netrin-1 and KIM-1 as early biomarkers for septic acute kidney injury.
25022751 2014 Comparison of two in vitro angiogenesis assays for evaluating the effects of netrin-1 on tube formation.
25001177 2014 Netrin-1 promoted pancreatic cancer cell proliferation by upregulation of Mdm2.
24827071 2014 Netrin-1 ameliorates myocardial infarction-induced myocardial injury: mechanisms of action in rats and diabetic mice.
24812271 2014 Netrin-1 promotes medulloblastoma cell invasiveness and angiogenesis, and demonstrates elevated expression in tumor tissue and urine of patients with pediatric medulloblastoma.
24778312 2014 A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.
24738865 2014 Netrin-1 induces MMP-12-dependent E-cadherin degradation via the distinct activation of PKC? and FAK/Fyn in promoting mesenchymal stem cell motility.
24716747 2014 Cord blood netrin-1 and -4 concentrations in term pregnancies with normal, restricted and increased fetal growth.
24647424 2014 Netrin-1 expression is an independent prognostic factor for poor patient survival in brain metastases.
24584118 2014 Netrin-1 promotes adipose tissue macrophage retention and insulin resistance in obesity.
24528886 2014 PKC ? regulates netrin-1/UNC5B-mediated survival pathway in bladder cancer.
24442237 2014 Netrin-1 induces epithelial-mesenchymal transition and promotes hepatocellular carcinoma invasiveness.
24338005 2014 Netrin-1 as a potential target for metastatic cancer: focus on colorectal cancer.
24293316 2013 Combining chemotherapeutic agents and netrin-1 interference potentiates cancer cell death.
24262644 2014 The neuroimmune guidance cue netrin-1: a new therapeutic target in cardiovascular disease.
24174661 2013 Netrin-1 promotes excitatory synaptogenesis between cortical neurons by initiating synapse assembly.
24122613 2013 Association of neuroimmune guidance cue netrin-1 and its chemorepulsive receptor UNC5B with atherosclerotic plaque expression signatures and stability in human(s): Tampere Vascular Study (TVS).
24092381 2014 Tubular atrophy and low netrin-1 gene expression are associated with delayed kidney allograft function.
23666553 2013 Interactional expression of netrin-1 and its dependence receptor UNC5B in prostate carcinoma.
23549787 2013 Netrin-1-induced activation of Notch signaling mediates glioblastoma cell invasion.
23538444 2013 Netrin-1 protects hypoxia-induced mitochondrial apoptosis through HSP27 expression via DCC- and integrin ?6?4-dependent Akt, GSK-3?, and HSF-1 in mesenchymal stem cells.
23526078 2013 PKC? is involved in the progression of kidney carcinoma through regulating netrin-1/UNC5B signaling pathway.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
23319801 2013 Identification of inherited genetic variations influencing prognosis in early-onset breast cancer.
23195957 2013 Netrin-1 promotes glioblastoma cell invasiveness and angiogenesis by multiple pathways including activation of RhoA, cathepsin B, and cAMP-response element-binding protein.
22889408 2012 Netrin-1 concentrations in patients with advanced gastric cancer and its relation with treatment.
22871610 2012 Nucleolar localization of a netrin-1 isoform enhances tumor cell proliferation.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
22779713 2012 Mutation analysis of Netrin 1 and HMX3 genes in patients with superior semicircular canal dehiscence syndrome.
22685302 2012 Down syndrome cell adhesion molecule (DSCAM) associates with uncoordinated-5C (UNC5C) in netrin-1-mediated growth cone collapse.
22588384 2012 Increased expression of netrin-1 and its deleted in colorectal cancer receptor in human diseased lumbar intervertebral disc compared with autopsy control.
22332546 2011 [Netrin-1 protein expression in gastric cancer and its correlation with clinicopathologic features and prognosis].
22252496 2011 Hypoxia-inducible factor 1 controls the expression of the uncoordinated-5-B receptor, but not of netrin-1, in first trimester human placenta.
22231519 2012 The neuroimmune guidance cue netrin-1 promotes atherosclerosis by inhibiting the emigration of macrophages from plaques.
21980448 2011 Autocrine netrin function inhibits glioma cell motility and promotes focal adhesion formation.
21789787 2011 Netrin-1 overexpression is predictive of ovarian malignancies.
21740336 2011 Urine neutrophil gelatinase-associated lipocalin (uNGAL) and netrin-1: are they effectively improving the clinical management of sepsis-induced acute kidney injury (AKI)?
21733374 2011 [In vivo and in vitro research study of the influence on placenta angiogenesis by gene silencing of netrin-1].
21505994 2011 Role of axonal guidance factor netrin-1 in human placental vascular growth.
21303223 2011 Plasma netrin-1 is a diagnostic biomarker of human cancers.
21193949 2011 Reduced expression of netrin-1 is associated with fetal growth restriction.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20620466 2010 Netrin-1: a novel universal biomarker of human kidney injury.
20609112 2010 Spatio-temporal deleted in colorectal cancer (DCC) and netrin-1 expression in human foetal brain development.
20434207 2010 Transmembrane receptor DCC associates with protein synthesis machinery and regulates translation.
20305387 2010 Netrin-1, a missing link between chronic inflammation and tumor progression.
20080097 2010 Netrin-1 mediates early events in pancreatic adenocarcinoma progression, acting on tumor and endothelial cells.
20075388 2010 Netrin-1 dampens pulmonary inflammation during acute lung injury.
20036673 2010 New discovery of Netrin-1 in cardioprotection.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
20007677 2010 Urinary netrin-1 is an early predictive biomarker of acute kidney injury after cardiac surgery.
19940358 2009 Functional implication of Netrin expression in malignant melanoma.
19826074 2010 Characterization and expression of netrin-1 and its receptors UNC5B and DCC in human placenta.
19822088 Role of the netrin system of repellent factors on synovial fibroblasts in rheumatoid arthritis and osteoarthritis.
19349462 2009 Netrin-1 acts as a survival factor for aggressive neuroblastoma.
19211441 2009 Interference with netrin-1 and tumor cell death in non-small cell lung cancer.
19196994 2009 DSCAM functions as a netrin receptor in commissural axon pathfinding.
19122655 2009 Hypoxia-inducible factor-dependent induction of netrin-1 dampens inflammation caused by hypoxia.
18922894 2008 Netrin-1 induces apoptosis in human cervical tumor cells via the TAp73alpha tumor suppressor.
18796601 2008 Netrin-1 is a survival factor during commissural neuron navigation.
18692059 2008 NF-kappaB regulates netrin-1 expression and affects the conditional tumor suppressive activity of the netrin-1 receptors.
18653556 2008 Rho inhibition recruits DCC to the neuronal plasma membrane and enhances axon chemoattraction to netrin 1.
18469807 2008 Netrin-1 mediates neuronal survival through PIKE-L interaction with the dependence receptor UNC5B.
18455953 2009 Netrin-1: diversity in development.
18439993 2008 Netrin-1 inhibits sprouting angiogenesis in developing avian embryos.
18400890 2008 Soluble adenylyl cyclase is not required for axon guidance to netrin-1.
18353983 2008 Netrin-1 expression confers a selective advantage for tumor cell survival in metastatic breast cancer.
18253061 2008 Tyrosine phosphorylation of netrin receptors in netrin-1 signaling.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16203981 2005 Netrin-1 inhibits leukocyte migration in vitro and in vivo.
16181408 2005 Netrin induces down-regulation of its receptor, Deleted in Colorectal Cancer, through the ubiquitin-proteasome pathway in the embryonic cortical neuron.
16158190 2005 Netrin-1: when a neuronal guidance cue turns out to be a regulator of tumorigenesis.
15811950 2005 DCC association with lipid rafts is required for netrin-1-mediated axon guidance.
15574733 2004 Mapping netrin receptor binding reveals domains of Unc5 regulating its tyrosine phosphorylation.
15573119 2004 Netrin-1 and its receptors in tumorigenesis.
15491747 2004 Expression of DCC and netrin-1 in normal human endometrium and its implication in endometrial carcinogenesis.
15343335 2004 Netrin-1 controls colorectal tumorigenesis by regulating apoptosis.
14602071 2003 Recognition of the neural chemoattractant Netrin-1 by integrins alpha6beta4 and alpha3beta1 regulates epithelial cell adhesion and migration.
12810718 2003 Netrin binds discrete subdomains of DCC and UNC5 and mediates interactions between DCC and heparin.
12636918 2003 Netrin-1/neogenin interaction stabilizes multipotent progenitor cap cells during mammary gland morphogenesis.
12149262 2002 The adaptor protein Nck-1 couples the netrin-1 receptor DCC (deleted in colorectal cancer) to the activation of the small GTPase Rac1 through an atypical mechanism.
11356879 2001 Widespread expression of netrin-1 by neurons and oligodendrocytes in the adult mammalian spinal cord.
11048721 2000 Netrin-1-mediated axon outgrowth and cAMP production requires interaction with adenosine A2b receptor.
10996153 2000 Expression of mRNA for axon guidance molecules, such as semaphorin-III, netrins and neurotrophins, in human osteoblasts and osteoclasts.
10102268 1999 Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance.
9950216 1999 Netrin-1: interaction with deleted in colorectal cancer (DCC) and alterations in brain tumors and neuroblastomas.
9858595 1999 Siah-1 N-terminal RING domain is required for proteolysis function, and C-terminal sequences regulate oligomerization and binding to target proteins.
8978605 1996 Netrin-1 is required for commissural axon guidance in the developing vertebrate nervous system.
8861902 1996 Deleted in Colorectal Cancer (DCC) encodes a netrin receptor.