1. Home
  2. Targets
  3. receptor
  4. Neurotrimin

Tbio Neurotrimin

Neural cell adhesion molecule.

This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic mechanism. This gene is closely linked to a related family member, opioid binding protein/cell adhesion molecule-like (OPCML), on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]

 Comments

Property Summary

NCBI Gene PubMed Count 28
PubMed Score 43.37
PubTator Score 73.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Autistic Disorder 320 0.0 1.0
Cognitive disorder 44 0.0 1.0
Disease Target Count Z-score Confidence
Juvenile pilocytic astrocytoma 2 4.057 2.0
Chagas disease 34 3.114 1.6

Expression

  Differential Expression (21)

Disease log2 FC p
urothelial carcinoma 1.400 5.0e-02
malignant mesothelioma 5.200 3.9e-09
permanent atrial fibrillation -1.300 3.7e-04
psoriasis -1.300 1.0e-27
glioblastoma -2.500 3.0e-04
sonic hedgehog group medulloblastoma -3.100 1.5e-10
cystic fibrosis 3.682 6.3e-08
atypical teratoid / rhabdoid tumor -4.100 2.6e-09
medulloblastoma, large-cell -4.500 2.4e-05
primary pancreatic ductal adenocarcinoma 2.811 4.7e-04
intraductal papillary-mucinous adenoma (... -1.700 2.9e-02
lung cancer -3.800 5.8e-07
pancreatic cancer 2.800 6.0e-04
lung adenocarcinoma -1.100 1.4e-03
pediatric high grade glioma -2.100 1.1e-04
subependymal giant cell astrocytoma -2.457 4.8e-02
Breast cancer 1.800 1.0e-02
invasive ductal carcinoma 2.068 2.1e-03
lung carcinoma -1.600 1.6e-03
ovarian cancer 2.400 3.0e-02
Gaucher disease type 3 1.100 4.7e-02

Synonym

Accession Q9P121 A0MTT2 Q6UXJ3 Q86VJ9 hNT
Symbols HNT
NTRI
IGLON2

Gene

NTM

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 UniProt Keyword (14)

See all...

 GO Component (2)

 GO Process (2)

 Compartment GO Term (9)

 GWAS Trait (8)

 HCA RNA Cell Line (42)

See all...

 CSPA Cell Line (1)

Pathway (3)

Protein-protein Interaction (4)

GPLD1   OPCML   CALR   FBXO2  

Gene RIF (12)

PMID Text
26334118 NTM is not a susceptibility gene for autism spectrum disorders.
25819087 Both the AFF3 and NTM triglyceride associations were replicated among Multi-ethnic Study of Atherosclerosis study participants (P = 1.00 x 10(-7) and 8.00 x 10(-5), respectively).
24616287 The generation and cardiac phenotype of single and double heterozygous gene-targeted OPCML and Neurotrimin knockout mice.
23054244 A translocation breaks intron 1 of a splicing isoform of Neurotrimin at 11q25 in a family with intracranial and thoracic aortic aneurysm.
22661486 A quantitative analysis of central corneal thickness and a subsequent analysis of primary open-angle glaucoma (POAG), SNPs in two cell adhesion molecules, NTM and CNTNAP4, were identified and may increase POAG susceptibility in a subset of cases.
21036197 The finding of this study provided evidence that NTM at 11q25 chromosome regions affecting IQ.
21036197 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15379248 Human neurotrimin is expressed on the surface of CHO cells and could strengthen their aggregation.
12819783 NTM shows close linkage to OPCML on chromosome 11q25.

AA Sequence 

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLN      1 - 70
RSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE     71 - 140
ISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAP    141 - 210
VVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKL    211 - 280
IFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF          281 - 344
//

Text Mined References (28)

PMID Year Title
26334118 2015 11q24.2-25 micro-rearrangements in autism spectrum disorders: Relation to brain structures.
25819087 2015 Genome-wide linkage and positional association analyses identify associations of novel AFF3 and NTM genes with triglycerides: the GenSalt study.
25416956 2014 A proteome-scale map of the human interactome network.
24616287 2014 Gene-targeted deletion of OPCML and Neurotrimin in mice does not yield congenital heart defects.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23054244 2012 A balanced translocation truncates Neurotrimin in a family with intracranial and thoracic aortic aneurysm.
22661486 2012 Genome-wide analysis of central corneal thickness in primary open-angle glaucoma cases in the NEIGHBOR and GLAUGEN consortia.
22633400 2012 Genome-wide association study identifies candidate genes for male fertility traits in humans.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21182207 2010 Variants in several genomic regions associated with asperger disorder.
21036197 2011 NTM and NR3C2 polymorphisms influencing intelligence: family-based association studies.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15379248 2004 The cloning and preliminarily functional analysis of the human neurotrimin gene.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12819783 2003 OPCML at 11q25 is epigenetically inactivated and has tumor-suppressor function in epithelial ovarian cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7891157 1995 Cloning of neurotrimin defines a new subfamily of differentially expressed neural cell adhesion molecules.