| Tbio | Neurotrimin |
Neural cell adhesion molecule.
This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic mechanism. This gene is closely linked to a related family member, opioid binding protein/cell adhesion molecule-like (OPCML), on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]
This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic mechanism. This gene is closely linked to a related family member, opioid binding protein/cell adhesion molecule-like (OPCML), on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]
Comments
| Disease | Target Count |
|---|---|
| Major Depressive Disorder | 301 |
| Unipolar Depression | 250 |
| Disease | Target Count | P-value |
|---|---|---|
| atypical teratoid / rhabdoid tumor | 5112 | 6.5e-10 |
| malignant mesothelioma | 3232 | 3.9e-09 |
| group 3 medulloblastoma | 4104 | 1.1e-07 |
| glioblastoma | 5792 | 1.5e-07 |
| cystic fibrosis | 1696 | 4.9e-07 |
| medulloblastoma, large-cell | 6241 | 8.1e-06 |
| adult high grade glioma | 3801 | 9.4e-06 |
| permanent atrial fibrillation | 45 | 3.7e-04 |
| primary pancreatic ductal adenocarcinoma | 1109 | 4.7e-04 |
| pancreatic cancer | 2398 | 8.8e-04 |
| lung adenocarcinoma | 2716 | 1.4e-03 |
| invasive ductal carcinoma | 2951 | 1.5e-03 |
| lung carcinoma | 2843 | 1.6e-03 |
| lung cancer | 4740 | 2.0e-03 |
| psoriasis | 6694 | 2.4e-03 |
| Breast cancer | 3578 | 1.0e-02 |
| intraductal papillary-mucinous adenoma (IPMA) | 2955 | 2.9e-02 |
| ovarian cancer | 8520 | 3.3e-02 |
| Gaucher disease type 3 | 67 | 4.7e-02 |
| subependymal giant cell astrocytoma | 2287 | 4.8e-02 |
| urothelial carcinoma | 318 | 5.0e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Autistic Disorder | 364 | 0.0 | 1.2 |
| Cognitive disorder | 50 | 0.0 | 1.1 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Juvenile pilocytic astrocytoma | 1 | 4.138 | 2.1 |
| Chagas disease | 39 | 3.526 | 1.8 |
| Disease | log2 FC | p |
|---|---|---|
| adult high grade glioma | -1.600 | 9.4e-06 |
| atypical teratoid / rhabdoid tumor | -3.200 | 6.5e-10 |
| Breast cancer | 1.800 | 1.0e-02 |
| cystic fibrosis | 2.747 | 4.9e-07 |
| Gaucher disease type 3 | 1.100 | 4.7e-02 |
| glioblastoma | -1.900 | 1.5e-07 |
| group 3 medulloblastoma | -2.600 | 1.1e-07 |
| intraductal papillary-mucinous adenoma (... | -1.700 | 2.9e-02 |
| invasive ductal carcinoma | 1.391 | 1.5e-03 |
| lung adenocarcinoma | -1.100 | 1.4e-03 |
| lung cancer | -2.100 | 2.0e-03 |
| lung carcinoma | -1.600 | 1.6e-03 |
| malignant mesothelioma | 5.200 | 3.9e-09 |
| medulloblastoma, large-cell | -2.900 | 8.1e-06 |
| ovarian cancer | 1.700 | 3.3e-02 |
| pancreatic cancer | 1.200 | 8.8e-04 |
| permanent atrial fibrillation | -1.300 | 3.7e-04 |
| primary pancreatic ductal adenocarcinoma | 2.811 | 4.7e-04 |
| psoriasis | -1.100 | 2.4e-03 |
| subependymal giant cell astrocytoma | -2.457 | 4.8e-02 |
| urothelial carcinoma | 1.400 | 5.0e-02 |
| Species | Source | Disease |
|---|---|---|
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA |
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLN 1 - 70 RSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE 71 - 140 ISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAP 141 - 210 VVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKL 211 - 280 IFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF 281 - 344 //
