Tbio | Neurotrimin |
Neural cell adhesion molecule.
This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic mechanism. This gene is closely linked to a related family member, opioid binding protein/cell adhesion molecule-like (OPCML), on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]
This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic mechanism. This gene is closely linked to a related family member, opioid binding protein/cell adhesion molecule-like (OPCML), on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]
Comments
Disease | Target Count |
---|---|
Major Depressive Disorder | 301 |
Unipolar Depression | 250 |
Disease | Target Count | P-value |
---|---|---|
atypical teratoid / rhabdoid tumor | 5112 | 6.5e-10 |
malignant mesothelioma | 3232 | 3.9e-09 |
group 3 medulloblastoma | 4104 | 1.1e-07 |
glioblastoma | 5792 | 1.5e-07 |
cystic fibrosis | 1696 | 4.9e-07 |
medulloblastoma, large-cell | 6241 | 8.1e-06 |
adult high grade glioma | 3801 | 9.4e-06 |
permanent atrial fibrillation | 45 | 3.7e-04 |
primary pancreatic ductal adenocarcinoma | 1109 | 4.7e-04 |
pancreatic cancer | 2398 | 8.8e-04 |
lung adenocarcinoma | 2716 | 1.4e-03 |
invasive ductal carcinoma | 2951 | 1.5e-03 |
lung carcinoma | 2843 | 1.6e-03 |
lung cancer | 4740 | 2.0e-03 |
psoriasis | 6694 | 2.4e-03 |
Breast cancer | 3578 | 1.0e-02 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 2.9e-02 |
ovarian cancer | 8520 | 3.3e-02 |
Gaucher disease type 3 | 67 | 4.7e-02 |
subependymal giant cell astrocytoma | 2287 | 4.8e-02 |
urothelial carcinoma | 318 | 5.0e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Autistic Disorder | 364 | 0.0 | 1.2 |
Cognitive disorder | 50 | 0.0 | 1.1 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Juvenile pilocytic astrocytoma | 1 | 4.138 | 2.1 |
Chagas disease | 39 | 3.526 | 1.8 |
Disease | log2 FC | p |
---|---|---|
adult high grade glioma | -1.600 | 9.4e-06 |
atypical teratoid / rhabdoid tumor | -3.200 | 6.5e-10 |
Breast cancer | 1.800 | 1.0e-02 |
cystic fibrosis | 2.747 | 4.9e-07 |
Gaucher disease type 3 | 1.100 | 4.7e-02 |
glioblastoma | -1.900 | 1.5e-07 |
group 3 medulloblastoma | -2.600 | 1.1e-07 |
intraductal papillary-mucinous adenoma (... | -1.700 | 2.9e-02 |
invasive ductal carcinoma | 1.391 | 1.5e-03 |
lung adenocarcinoma | -1.100 | 1.4e-03 |
lung cancer | -2.100 | 2.0e-03 |
lung carcinoma | -1.600 | 1.6e-03 |
malignant mesothelioma | 5.200 | 3.9e-09 |
medulloblastoma, large-cell | -2.900 | 8.1e-06 |
ovarian cancer | 1.700 | 3.3e-02 |
pancreatic cancer | 1.200 | 8.8e-04 |
permanent atrial fibrillation | -1.300 | 3.7e-04 |
primary pancreatic ductal adenocarcinoma | 2.811 | 4.7e-04 |
psoriasis | -1.100 | 2.4e-03 |
subependymal giant cell astrocytoma | -2.457 | 4.8e-02 |
urothelial carcinoma | 1.400 | 5.0e-02 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA |
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLN 1 - 70 RSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE 71 - 140 ISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAP 141 - 210 VVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKL 211 - 280 IFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF 281 - 344 //