Property Summary

NCBI Gene PubMed Count 51
PubMed Score 351.00
PubTator Score 166.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Protein-protein Interaction (1)

Gene RIF (32)

PMID Text
25613138 The gene expression of neurotrophin 4 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25275256 No differences in plasma BDNF, NGF, NT3, NT4 and GDNF were found between autism spectrum disorders and control.
24607879 Elevated intra-amniotic levels of docosahexaenoic acid and arachidonic acid in the mid-trimester are correlated with increased NT4 concentrations.
23869086 Patients with mastocytosis featured elevated serum levels of NGF, NT-3, and NT-4. TrkA, TrkB, and TrkC expression was also elevated.
22815630 The NTF4 variants p.Gly157Ala and p.Ala182Val have been shown to be functional mutations, occurring in 2 of a total of 720 Chinese primary open-angle glaucoma patients.
22192858 Studies indicate neurotrophin family comprises nerve growth factor, brain-derived neurotrophic factor, neurotrophin-3 and neurotrophin-4 , and Zn(2+) and Cu(2+) interactions with them and modulate their activities through conformational changes.
22036954 NT-4/5 expression is associated with atrophy of the brain-parenchymal fraction measured by magnetic resonance imaging methods in patients with relapsing-remitting multiple sclerosis.
21350004 neurotrophin 4 contributes to breast cancer cell survival and can serve as prospective target to inhibit tumor growth
21330466 Suggest that a dysregulated TrkB/NT4/5 axis may contribute to several of the pathological lesions associated with pulmonary fibrosis, including type 2 alveolar cell hyperplasia and the proliferation of fibroblasts.
20806036 Identification of a single mutation in our study suggests that NTF4 mutations are a rare cause of primary open-angle glaucoma (0.6%, 95%CI 0.02%-3.16%) in Chinese people.
20806036 Observational study of gene-disease association. (HuGE Navigator)
20463313 present data indicate a lack of involvement of variations in NTF4, VAV2, and VAV3 with glaucoma pathogenesis in an Indian population.
20463313 Observational study of gene-disease association. (HuGE Navigator)
20447632 In vitro follicular assembly is significantly increased in fetal ovaries cultured with NT-4.
20219210 Observational study of gene-disease association. (HuGE Navigator)
20215012 No evidence of association of heterozygous NTF4 mutations in patients with primary open-angle glaucoma.
20215012 Observational study of gene-disease association. (HuGE Navigator)
20175187 Expression of human NTF4 was unchanged during gestation in the developping ovary.
19765683 NTF4 mutations impair neurotrophin-4 signaling in patients with primary open-angle glaucoma and lead to decreased activation of TrkB
19598235 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19081579 Data show that the levels of NT-4/5 levels are significantly higher in bipolar disorder patients than in controlsNT-4/5. immunocontent alterations in bipolar disorder.
18980528 Neurotrophin 4/5 plays a role in the proliferation and differentiation of periodontal ligament cells.
18305571 NT-3, NT-4, and nerve growth factor (NGF) induce cell migration in melanoma, with a stronger effect on metastatic cell lines.
18203754 Observational study of gene-disease association. (HuGE Navigator)
18179783 Observational study of gene-disease association. (HuGE Navigator)
16648236 These novel data demonstrate that neurotrophins influence ASM [Ca(2+)](i) and force regulation and suggest a potential role for neurotrophins in airway diseases
16648150 Results revealed the expression of NT-4/5 mainly in oocytes and, in a minority of samples, also in the granulosa cells (GCs).
16316409 Re-expression of the p75NTR appears to partially reverse de-differentiation of prostate cancer cells by up-regulating the expression of CRABPI for localized sequestration of retinoids.
15987945 A mechanism to understand the defect associated with variant BDNF and provide a framework two ligands for BDNF and NT-4.
12900521 Data suggest that activation of bronchial eosinophils by neurotrophins (nerve growth factor, brain-derived neurotrophic factor, neurotrophins-3 and -4) might play a role in the regulation of eosinophilic inflammation in allergic asthma.
12397373 The gene expression of this protein was studied in the developing human tooth.

AA Sequence

MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRES      1 - 70
AGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETR     71 - 140
CKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA    141 - 210
//

Text Mined References (51)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25275256 2014 Circulating levels of neurotrophic factors in autism spectrum disorders.
24607879 2014 Association between neurotrophin 4 and long-chain polyunsaturated fatty acid levels in mid-trimester amniotic fluid.
23869086 2013 Increased circulating levels of neurotrophins and elevated expression of their high-affinity receptors on skin and gut mast cells in mastocytosis.
22815630 2012 Evaluation of NTF4 as a causative gene for primary open-angle glaucoma.
22192858 2012 The inorganic perspectives of neurotrophins and Alzheimer's disease.
22036954 2011 Immune cell NT-3 expression is associated with brain atrophy in multiple sclerosis patients.
21350004 2011 Brain-derived neurotrophic factor and neurotrophin-4/5 are expressed in breast cancer and can be targeted to inhibit tumor cell survival.
21330466 2011 Neurotrophic tyrosine kinase receptor B/neurotrophin 4 signaling axis is perturbed in clinical and experimental pulmonary fibrosis.
20806036 2010 Identification of a novel mutation in the NTF4 gene that causes primary open-angle glaucoma in a Chinese population.
20463313 2010 Variations in NTF4, VAV2, and VAV3 genes are not involved with primary open-angle and primary angle-closure glaucomas in an indian population.
20447632 2011 Neurotrophin 4 enhances in vitro follicular assembly in human fetal ovaries.
20219210 2010 Role of the neurotrophin network in eating disorders' subphenotypes: body mass index and age at onset of the disease.
20215012 2010 No evidence of association of heterozygous NTF4 mutations in patients with primary open-angle glaucoma.
20175187 2010 Differential expression and regulation by activin of the neurotrophins BDNF and NT4 during human and mouse ovarian development.
19765683 2009 Heterozygous NTF4 mutations impairing neurotrophin-4 signaling in patients with primary open-angle glaucoma.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19081579 2009 Increased serum neurotrophin-4/5 levels in bipolar disorder.
18980528 2008 Effect of neurotrophin-4/5 on bone/cementum-related protein expressions and DNA synthesis in cultures of human periodontal ligament cells.
18305571 2008 Neurotrophins and their receptors stimulate melanoma cell proliferation and migration.
18203754 2008 Association of NTRK3 and its interaction with NGF suggest an altered cross-regulation of the neurotrophin signaling pathway in eating disorders.
18179783 2008 Association study of 10 genes encoding neurotrophic factors and their receptors in adult and child attention-deficit/hyperactivity disorder.
16648236 2006 Neurotrophin effects on intracellular Ca2+ and force in airway smooth muscle.
16648150 2006 Tyrosine kinase B receptor and its activated neurotrophins in ovaries from human fetuses and adults.
16316409 2005 A novel function of differentiation revealed by cDNA microarray profiling of p75NTR-regulated gene expression.
15987945 2005 Sortilin controls intracellular sorting of brain-derived neurotrophic factor to the regulated secretory pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12900521 2003 The neurotrophins nerve growth factor, brain-derived neurotrophic factor, neurotrophin-3, and neurotrophin-4 are survival and activation factors for eosinophils in patients with allergic bronchial asthma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397373 2002 Expression patterns of neurotrophic factor mRNAs in developing human teeth.
11855816 2002 A discrete domain of the human TrkB receptor defines the binding sites for BDNF and NT-4.
11738045 2001 Specificity in Trk receptor:neurotrophin interactions: the crystal structure of TrkB-d5 in complex with neurotrophin-4/5.
10908605 2000 Cell surface Trk receptors mediate NGF-induced survival while internalized receptors regulate NGF-induced differentiation.
10869436 2000 Deficient long-term memory and long-lasting long-term potentiation in mice with a targeted deletion of neurotrophin-4 gene.
10681461 2000 Loss of brain-derived neurotrophic factor-dependent neural crest-derived sensory neurons in neurotrophin-4 mutant mice.
10631974 1999 The structures of the neurotrophin 4 homodimer and the brain-derived neurotrophic factor/neurotrophin 4 heterodimer reveal a common Trk-binding site.
10490030 1999 Crystal structure of nerve growth factor in complex with the ligand-binding domain of the TrkA receptor.
10479455 1999 NT4/5 mutant mice have deficiency in gustatory papillae and taste bud formation.
10388563 1999 Crystal structures of the neurotrophin-binding domain of TrkA, TrkB and TrkC.
9973328 1999 A new role for neurotrophins: involvement of brain-derived neurotrophic factor and neurotrophin-4 in hair cycle control.
9519408 1998 The 3-D structure of a folate-dependent dehydrogenase/cyclohydrolase bifunctional enzyme at 1.5 A resolution.
8873083 1996 Neurotrophin-4: the odd one out in the neurotrophin family.
8241191 1993 Heterodimers of the neurotrophic factors: formation, isolation, and differential stability.
8061955 1994 The conservation of neurotrophic factors during vertebrate evolution.
7703225 1995 Structure of the brain-derived neurotrophic factor/neurotrophin 3 heterodimer.
7541633 1995 Differential role of the low affinity neurotrophin receptor (p75) in retrograde axonal transport of the neurotrophins.
1742028 1991 Neurotrophin-5: a novel neurotrophic factor that activates trk and trkB.
1496419 1992 Human chromosome 19 contains the neurotrophin-5 gene locus and three related genes that may encode novel acidic neurotrophins.
1313578 1992 Mammalian neurotrophin-4: structure, chromosomal localization, tissue distribution, and receptor specificity.
925010 1977 Dissociation equilibrium constant of beta nerve growth factor.