Property Summary

NCBI Gene PubMed Count 10
PubMed Score 162.29
PubTator Score 65.62

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.179 4.0e-02
astrocytic glioma -1.400 3.9e-03
ependymoma -1.500 8.7e-03
oligodendroglioma -1.400 7.1e-03
psoriasis -1.300 1.3e-07
osteosarcoma -1.535 4.2e-06
medulloblastoma, large-cell -1.600 5.3e-04
group 4 medulloblastoma -1.300 5.5e-04
subependymal giant cell astrocytoma 1.516 1.9e-02
ovarian cancer -2.100 3.8e-09
dermatomyositis 1.100 2.8e-03


Accession Q96AB6 Q7Z4Z0
Symbols PNAA


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

21375249 Results indicate that hNTAN1 is highly selective for the hydrolysis of N-terminal peptidyl L-Asn.
18496130 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

PAHTLFSGNKALLYKKNEDGLWEKISSPGS                                            281 - 310

Text Mined References (10)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24816252 2014 An atlas of genetic influences on human blood metabolites.
21375249 2011 Expression and biochemical characterization of the human enzyme N-terminal asparagine amidohydrolase.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19786961 2011 Copy number variations of chromosome 16p13.1 region associated with schizophrenia.
18496130 2008 Genetic predictors of glucocorticoid-induced hypertension in children with acute lymphoblastic leukemia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.