Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.43
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 2.4e-02
astrocytic glioma -1.600 6.4e-03
cystic fibrosis 1.459 1.1e-05
ependymoma -1.500 1.5e-02
glioblastoma -1.100 9.3e-03
group 4 medulloblastoma -1.500 2.8e-03
intraductal papillary-mucinous adenoma (... 1.300 3.7e-03
invasive ductal carcinoma -1.100 4.3e-03
oligodendroglioma -1.500 1.3e-02
osteosarcoma -1.924 8.6e-05
ovarian cancer -1.400 2.0e-04
progressive supranuclear palsy -1.100 4.5e-02

Gene RIF (4)

AA Sequence

MAQHFSLAACDVVGFDLDHTLCRYNLPESAPLIYNSFAQFLVKEKGYDKELLNVTPEDWDFCCKGLALDL      1 - 70
EDGNFLKLANNGTVLRASHGTKMMTPEVLAEAYGKKEWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCA     71 - 140
RVVDYLTKLNNGQKTFDFWKDIVAAIQHNYKMSAFKENCGIYFPEIKRDPGRYLHSCPESVKKWLRQLKN    141 - 210
AGKILLLITSSHSDYCRLLCEYILGNDFTDLFDIVITNALKPGFFSHLPSQRPFRTLENDEEQEALPSLD    211 - 280
KPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELRGDEGTRSQRPEE    281 - 350
SEPLEKKGKYEGPKAKPLNTSSKKWGSFFIDSVLGLENTEDSLVYTWSCKRISTYSTIAIPSIEAIAELP    351 - 420
LDYKFTRFSSSNSKTAGYYPNPPLVLSSDETLISK                                       421 - 455
//

Text Mined References (14)

PMID Year Title