Property Summary

NCBI Gene PubMed Count 40
PubMed Score 156.37
PubTator Score 664.17

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (8)

Gene RIF (18)

PMID Text
26259531 Leukemia Relapse-Associated Mutation of NT5C2 Gene is Rare in de Novo Acute Leukemias and Solid Tumors.
25857773 Data indicate that type II cytosolic 5'-nucleotidase (cN-II) exerts a role in nucleotide and drug metabolism and regulating cell survival.
25811392 cN-II co-immunoprecipitated both with wild type Ipaf and its LRR domain after transfection with corresponding expression vectors, but not with Ipaf lacking the LRR domain.
24861553 Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations.
23377281 results highlight the prominent role of relapse-specific mutations in NT5C2 as a mechanism of resistance to 6-Mercaptopurine and a genetic driver of relapse in acute lymphoblastic leukemia
23377183 These results suggest that mutations in NT5C2 are associated with the outgrowth of drug-resistant clones in acute lymphoblastic leukemia
23223233 analysis of Drosophila and human 7-methyl GMP-specific nucleotidases
22071413 Polymorphisms in the CYP17A1 and NT5C2 genes influence a reduction in both visceral and subcutaneous fat mass in Japanese women.
21396942 seven high-resolution structures of human cN-II, including a ligand-free form and complexes with various substrates and effectors, were presented.
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20542020 Observational study of gene-disease association. (HuGE Navigator)
19428333 The DCK/cN-II ratio was again proportional to ara-CTP production and to ara-C sensitivity.
18976975 Knockdown of 5'-nucleotidase, cytosolic II (NT5C2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18775979 In leukoblasts from 82 patients with acute myeloid leukemia, various extent and frequency of differential allelic expression in the CDA, DCK, NT5C2, NT5C3, and TP53 genes was observed.
17405878 Data describe the crystal structure of human cytosolic 5'-nucleotidase II and discuss its allosteric regulation and substrate recognition.
17350683 the expression level of cN-II mRNA might be a prognostic factor of high-risk MDS.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15923058 cN-II has a role in protecting against progression of non-small cell lung cancer

AA Sequence

MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGF      1 - 70
ELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNK     71 - 140
FIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHY    141 - 210
KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQ    211 - 280
SYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIG    281 - 350
DHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ    351 - 420
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTV    421 - 490
EHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE    491 - 560
E//

Text Mined References (45)

PMID Year Title
26259531 2016 Leukemia Relapse-Associated Mutation of NT5C2 Gene is Rare in de Novo Acute Leukemias and Solid Tumors.
25857773 2015 IMP-GMP specific cytosolic 5'-nucleotidase regulates nucleotide pool and prodrug metabolism.
25811392 2015 Cytosolic 5'-nucleotidase II interacts with the leucin rich repeat of NLR family member Ipaf.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24001895 2013 Genome-wide association study meta-analysis reveals transethnic replication of mean arterial and pulse pressure loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23377281 2013 Activating mutations in the NT5C2 nucleotidase gene drive chemotherapy resistance in relapsed ALL.
23377183 2013 Relapse-specific mutations in NT5C2 in childhood acute lymphoblastic leukemia.
23223233 2013 Identification of Drosophila and human 7-methyl GMP-specific nucleotidases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22071413 2012 Genetic variations in the CYP17A1 and NT5C2 genes are associated with a reduction in visceral and subcutaneous fat areas in Japanese women.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21396942 2011 Structural basis for the allosteric regulation and substrate recognition of human cytosolic 5'-nucleotidase II.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
21045733 2011 Discovery and replication of novel blood pressure genetic loci in the Women's Genome Health Study.
20542020 2010 Confirmation of top polymorphisms in hypertension genome wide association study among Han Chinese.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19428333 2009 Intracellular cytarabine triphosphate production correlates to deoxycytidine kinase/cytosolic 5'-nucleotidase II expression ratio in primary acute myeloid leukemia cells.
19060904 2009 An empirical framework for binary interactome mapping.
18775979 2008 Differential allelic expression in leukoblast from patients with acute myeloid leukemia suggests genetic regulation of CDA, DCK, NT5C2, NT5C3, and TP53.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17405878 2007 Crystal structure of human cytosolic 5'-nucleotidase II: insights into allosteric regulation and substrate recognition.
17350683 2007 Clinical significance of high-Km 5'-nucleotidase (cN-II) mRNA expression in high-risk myelodysplastic syndrome.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15923058 2005 cN-II expression predicts survival in patients receiving gemcitabine for advanced non-small cell lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7999131 1994 Molecular cloning of human cytosolic purine 5'-nucleotidase.
2848805 1988 High Km soluble 5'-nucleotidase from human placenta. Properties and allosteric regulation by IMP and ATP.
2839573 1988 Immunocytochemical localization of cytosol 5'-nucleotidase in chicken liver.