Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.40
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 2.3e-09
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 4.275 2.1
Supravalvular aortic stenosis 6 3.631 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 2.3e-09

Gene RIF (1)

PMID Text
11978965 Characterization of two novel genes, WBSCR20 and WBSCR22, deleted in Williams-Beuren syndrome

AA Sequence

MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHL      1 - 70
AKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRV     71 - 140
NTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL    141 - 210
QDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCE    211 - 280
LAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPS    281 - 350
LQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVA    351 - 420
VIERVEVPR                                                                 421 - 429
//

Text Mined References (16)

PMID Year Title
23913415 2013 Yeast Nop2 and Rcm1 methylate C2870 and C2278 of the 25S rRNA, respectively.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12073013 2002 Identification of additional transcripts in the Williams-Beuren syndrome critical region.
11978965 2001 Characterization of two novel genes, WBSCR20 and WBSCR22, deleted in Williams-Beuren syndrome.
9847074 1998 Toward a complete human genome sequence.