Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 5.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 3.0e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.000 3.0e-05

AA Sequence

MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIE      1 - 70
IKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKK     71 - 140
MRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIR    141 - 210
MHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH                  211 - 266
//

Text Mined References (14)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21364888 2011 Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.
21269460 2011 Initial characterization of the human central proteome.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
18086888 2008 Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701739 2004 Coordination of DNA damage responses via the Smc5/Smc6 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927594 2002 Identification of a novel non-structural maintenance of chromosomes (SMC) component of the SMC5-SMC6 complex involved in DNA repair.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.