Property Summary

NCBI Gene PubMed Count 14
PubMed Score 56.99
PubTator Score 26.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 6.1e-06
osteosarcoma 7933 2.8e-05
lung cancer 4473 4.9e-04
ovarian cancer 8491 4.3e-03
Waldenstrons macroglobulinemia 764 4.8e-03
Multiple myeloma 1327 3.5e-02
Disease Target Count Z-score Confidence
Malaria 140 4.349 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.402 4.8e-03
Multiple myeloma 1.234 3.5e-02
osteosarcoma -1.204 2.8e-05
lung cancer 1.300 4.9e-04
group 3 medulloblastoma 1.600 6.1e-06
ovarian cancer -1.300 4.3e-03

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20231385 The hMis14, which contains a tripartite-binding domain for HP1 and two other kinetochore proteins, hMis13 and blinkin, is a cornerstone for the assembly of the inner centromere and kinetochore.

AA Sequence

MAGSPELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKLGDALPEEIRE      1 - 70
PALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKT     71 - 140
IKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLRMQPV    141 - 210
IHLQRIHQEVFSSCHRKPDAKPENFITQIETTPTETASRKTSDMVLKRKQTKDCPQRKWYPLRPKKINLD    211 - 280
T//

Text Mined References (19)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20819937 2010 The MIS12 complex is a protein interaction hub for outer kinetochore assembly.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20231385 2010 Inner centromere formation requires hMis14, a trident kinetochore protein that specifically recruits HP1 to human chromosomes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17981135 2007 Human Blinkin/AF15q14 is required for chromosome alignment and the mitotic checkpoint through direct interaction with Bub1 and BubR1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16585270 2006 The human Mis12 complex is required for kinetochore assembly and proper chromosome segregation.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.