Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.01
PubTator Score 14.08

Knowledge Summary

Patent

No data available

Synonym

Accession P42857 B4DXC5 Q49AQ1
Symbols P21
D4S234
NEEP21
D4S234E

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
25376768 This review focuses on two closely related, neuron-enriched endosomal proteins: NEEP21 and Calcyon which perform distinct roles in regulating receptor endocytosis, recycling, and degradation--{REVIEW}
21084623 NEEP21 profoundly affects the processing of beta-amyloid precursor proteins and Abeta peptide production.
20878061 These results suggest that NEEP21 may play a critical role in apoptosis as a mediator of p53.
20599942 a novel p53-responsive gene D4S234E is accumulated in the ER and induces apoptosis in response to DNA damage.

AA Sequence

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFT      1 - 70
VSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAR     71 - 140
EKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA                             141 - 185
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25376768 2015 Complementary roles of the neuron-enriched endosomal proteins NEEP21 and calcyon in neuronal vesicle trafficking.
21084623 2010 Identification of NEEP21 as a ß-amyloid precursor protein-interacting protein in vivo that modulates amyloidogenic processing in vitro.
20878061 2010 Identification of NEEP21, encoding neuron-enriched endosomal protein of 21 kDa, as a transcriptional target of tumor suppressor p53.
20599942 2010 D4S234E, a novel p53-responsive gene, induces apoptosis in response to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070131 2002 Modulation of receptor cycling by neuron-enriched endosomal protein of 21 kD.
9013775 1996 Variable subcellular localization of a neuron-specific protein during NTera 2 differentiation into post-mitotic human neurons.