Property Summary

NCBI Gene PubMed Count 62
PubMed Score 688.77
PubTator Score 904.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.179 4.7e-04
adult high grade glioma -2.200 9.0e-08
astrocytic glioma -2.400 1.2e-03
Astrocytoma, Pilocytic -1.800 2.9e-10
atypical teratoid / rhabdoid tumor -2.800 2.0e-10
Chronic Lymphocytic Leukemia 1.449 8.5e-06
ependymoma -2.800 2.2e-03
glioblastoma -2.000 6.0e-10
group 3 medulloblastoma -1.200 2.9e-04
invasive ductal carcinoma 1.100 1.1e-02
lung carcinoma 1.700 1.2e-37
medulloblastoma, large-cell -2.400 7.9e-06
oligodendroglioma -1.600 2.4e-02
ovarian cancer 1.600 1.9e-04
Pick disease -1.800 8.8e-03
primitive neuroectodermal tumor -2.000 4.4e-05

Gene RIF (23)

AA Sequence

MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSIAFSLPQRKWA      1 - 70
GLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSF     71 - 140
NEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIIN    141 - 210
PDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAR    211 - 280
EPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTV    281 - 350
VNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL    351 - 420
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKP    421 - 490
AFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEES    491 - 560
NFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLL    561 - 630
KKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG    631 - 700
KKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD                              701 - 744
//

Text Mined References (68)

PMID Year Title