Property Summary

NCBI Gene PubMed Count 61
PubMed Score 669.63
PubTator Score 904.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
chronic lymphocytic leukemia 1.449 8.5e-06
astrocytic glioma -2.400 1.2e-03
ependymoma -2.800 2.2e-03
oligodendroglioma -1.900 8.9e-20
glioblastoma -2.800 5.0e-07
sonic hedgehog group medulloblastoma -2.900 7.6e-10
atypical teratoid / rhabdoid tumor -2.800 2.0e-10
medulloblastoma, large-cell -2.400 7.9e-06
primitive neuroectodermal tumor -2.000 4.4e-05
acute quadriplegic myopathy 1.179 4.7e-04
pediatric high grade glioma -2.400 1.8e-09
pilocytic astrocytoma -1.800 2.9e-10
lung carcinoma 1.700 1.2e-37
Pick disease -1.800 8.8e-03
invasive ductal carcinoma 1.100 1.1e-02
ovarian cancer 1.600 1.9e-04

Gene RIF (22)

PMID Text
23775070 a processive helicase-like mechanism for NSF in which approximately 1 residue is unwound for every hydrolyzed ATP molecule.
23125841 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22808325 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21680744 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21426264 Single and multiple-marker analyses revealed a strong association between cocaine dependence and the NSF gene.
21324905 Knockdown of TRX1 increases the level of S-nitrosylated NSF, prolongs the inhibition of exocytosis, and suppresses leukocyte
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20176016 NSF independent fusion of Salmonella-containing late phagosomes with early endosomes.
19533740 analysis of human NSF possible binding mode to GABARAP and GATE-16
19208619 Data show that phosphorylation of N-ethylmaleimide-sensitive factor on tyrosine residues prevents its SNARE complex dissociation activity and establish a role for PTP1B in the modulation of the membrane fusion machinery.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18836734 Data show that NSF is an inclusion body component in neuronal intranuclear inclusion disease identified by anti-SUMO-1-immunocapture.
18077426 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17510209 dual regulation on hbeta2AR trafficking and signaling by NSF through direct binding to cargo receptor and its ATPase activity.
16461345 Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein
15293277 Observational study of gene-disease association. (HuGE Navigator)
14769786 NSF dissociates the VAMP-2.SNAP-25.syntaxin 13 complex, but has no effect on the Hrs-containing complex.
14607937 Expressing a biochemically defined NSF mutant that lacks ATPase activity results in a dramatic inhibition of stimulated mast cell exocytosis.
14567912 Nitric oxide regulates exocytosis by S-nitrosylation of NSF.
12130635 role of interaction with GluR2 in regulation of AMPA receptors by brain-derived neurotrophic factor
12011465 binding of NSF to GluR2-containing AMPARs in stabilizing these receptors in the synaptic membrane and impeding their regulated endocytosis.

AA Sequence

MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSIAFSLPQRKWA      1 - 70
GLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSF     71 - 140
NEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIIN    141 - 210
PDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAR    211 - 280
EPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTV    281 - 350
VNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL    351 - 420
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKP    421 - 490
AFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEES    491 - 560
NFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLL    561 - 630
KKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG    631 - 700
KKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD                              701 - 744
//

Text Mined References (67)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23775070 2013 Processive ATP-driven substrate disassembly by the N-ethylmaleimide-sensitive factor (NSF) molecular machine.
23544013 2013 Genome-wide association study in BRCA1 mutation carriers identifies novel loci associated with breast and ovarian cancer risk.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22045810 2011 Protein-tyrosine phosphatase 1B modulates early endosome fusion and trafficking of Met and epidermal growth factor receptors.
21812969 2011 Genome-wide association study identifies candidate genes for Parkinson's disease in an Ashkenazi Jewish population.
21426264 2012 Candidate pathway association study in cocaine dependence: the control of neurotransmitter release.
21324905 2011 Thioredoxin increases exocytosis by denitrosylating N-ethylmaleimide-sensitive factor.
21269460 2011 Initial characterization of the human central proteome.
20711177 2010 Common genetic variation in the HLA region is associated with late-onset sporadic Parkinson's disease.
20562859 2010 Network organization of the human autophagy system.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20176016 2010 NSF independent fusion of Salmonella-containing late phagosomes with early endosomes.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19533740 2009 Comparative modeling of human NSF reveals a possible binding mode of GABARAP and GATE-16.
19208619 2009 PTP1B dephosphorylates N-ethylmaleimide-sensitive factor and elicits SNARE complex disassembly during human sperm exocytosis.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18836734 2008 NSF, Unc-18-1, dynamin-1 and HSP90 are inclusion body components in neuronal intranuclear inclusion disease identified by anti-SUMO-1-immunocapture.
18077426 2007 Runs of homozygosity reveal highly penetrant recessive loci in schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17897319 2007 Integral and associated lysosomal membrane proteins.
17510209 2007 N-ethylmaleimide-sensitive factor regulates beta2 adrenoceptor trafficking and signaling in cardiomyocytes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16724110 2006 Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16461345 2006 Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein: implications in the regulation of its hexamerization and exocytosis.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16055064 2005 PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
15858065 2005 Protein-protein coupling/uncoupling enables dopamine D2 receptor regulation of AMPA receptor-mediated excitotoxicity.
15613468 2005 Novel function for receptor activity-modifying proteins (RAMPs) in post-endocytic receptor trafficking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322554 2004 Control of vesicle fusion by a tyrosine phosphatase.
15293277 2004 Novel haplotypes in 17q21 are associated with progressive supranuclear palsy.
14769786 2004 Ca2+ and N-ethylmaleimide-sensitive factor differentially regulate disassembly of SNARE complexes on early endosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607937 2003 Mast cell degranulation requires N-ethylmaleimide-sensitive factor-mediated SNARE disassembly.
14567912 2003 Nitric oxide regulates exocytosis by S-nitrosylation of N-ethylmaleimide-sensitive factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130635 2002 Brain-derived neurotrophic factor regulates surface expression of alpha-amino-3-hydroxy-5-methyl-4-isoxazoleproprionic acid receptors by enhancing the N-ethylmaleimide-sensitive factor/GluR2 interaction in developing neocortical neurons.
12011465 2002 Differential roles for NSF and GRIP/ABP in AMPA receptor cycling.
11680900 2001 CD28 stimulation regulates its association with N-ethylmaleimide-sensitive fusion protein and other proteins involved in vesicle sorting.
11511104 2001 VAP-A binds promiscuously to both v- and tSNAREs.
11461150 2001 The subcellular distribution of GABARAP and its ability to interact with NSF suggest a role for this protein in the intracellular transport of GABA(A) receptors.
11403936 2001 A quantitative study on the expression of synapsin II and N-ethylmaleimide-sensitive fusion protein in schizophrenic patients.
10954749 2000 Calcium-triggered acrosomal exocytosis in human spermatozoa requires the coordinated activation of Rab3A and N-ethylmaleimide-sensitive factor.
10903204 2000 Rab1 recruitment of p115 into a cis-SNARE complex: programming budding COPII vesicles for fusion.
10747018 2000 GATE-16, a membrane transport modulator, interacts with NSF and the Golgi v-SNARE GOS-28.
10683148 2000 Preferential association of syntaxin 8 with the early endosome.
10196135 1999 Identification of NSF as a beta-arrestin1-binding protein. Implications for beta2-adrenergic receptor regulation.
9697855 1998 The AMPA receptor GluR2 C terminus can mediate a reversible, ATP-dependent interaction with NSF and alpha- and beta-SNAPs.
9362506 1997 Stimulation of NSF ATPase activity by alpha-SNAP is required for SNARE complex disassembly and exocytosis.
9349823 1997 A SNARE involved in protein transport through the Golgi apparatus.
9325254 1997 N-Ethylmaleimide-sensitive factor (NSF) and alpha-soluble NSF attachment proteins (SNAP) mediate dissociation of GS28-syntaxin 5 Golgi SNAP receptors (SNARE) complex.
9286697 1997 NVL: a new member of the AAA family of ATPases localized to the nucleus.
8973549 1996 Identification of SNAP receptors in rat adipose cell membrane fractions and in SNARE complexes co-immunoprecipitated with epitope-tagged N-ethylmaleimide-sensitive fusion protein.
8940356 1996 Molecular components of the exocytotic machinery in the rat pituitary gland.
8875895 1996 Localization of human and mouse N-ethylmaleimide-sensitive factor (NSF) gene: a two-domain member of the AAA family that is involved in membrane fusion.
8636227 1996 A v-SNARE implicated in intra-Golgi transport.
8051214 1994 N-ethylmaleimide-sensitive fusion protein: a trimeric ATPase whose hydrolysis of ATP is required for membrane fusion.
8013662 1994 The N-ethylmaleimide-sensitive fusion protein (NSF) is preferentially expressed in the nervous system.
7622514 1995 The N-ethylmaleimide-sensitive fusion protein and alpha-SNAP induce a conformational change in syntaxin.
1315316 1992 A multisubunit particle implicated in membrane fusion.