Property Summary

NCBI Gene PubMed Count 23
PubMed Score 157.54
PubTator Score 87.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (13)

PMID Text
24139947 In the cochlea, NTN immunostaining was found in the supporting cells of organ of Corti, including Deiters' cells, Hensen cells as well as Claudius' cells. In the spiral ganglia, NTN was seen in both the cell bodies and the nerve fibers of neurons.
24067900 Neurturin contributes toward an aggressive cancer cell phenotype, neuropathic pain and neuronal plasticity in pancreatic cancer.
22847529 Human neurturin protected crayfish neurons and glia from photodynamic injury.
21723942 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFRalpha2 isoforms.
18970938 No differences were found in the allelic frequencies of the variants or in the haplotype distribution between Hirschsprung's disease patients & controls, nor to any demographic/clinical parameters within the group of patients.
18970938 Observational study of gene-disease association. (HuGE Navigator)
18222320 GDNF, NTN, GFRalpha-1, GFRalpha-2, and c-Ret proteins are differentially expressed in the different stages of hair follicle cycle. GFRalpha-mediated signaling involves c-Ret and may play a role in human HF biology.
17522305 Depending on the brain's expressions of specific GDNF family GFRalpha2 receptor spliced isoforms, neurturin may promote or inhibit neurite outgrowth through the multicomponent receptor complex.
16895582 GDNF and NTN differentially regulate the expression of distinct miRNA precursors through the activation of mitogen-activated protein kinase
16081799 Addition of neurturin to activated peripheral blood mononuclear leukocytes reduces the amount of detectable tumor necrosis factor protein without altering its transcription.
15829225 The results obtained suggest the involvement of NTN, PSP, and ART in processes subserving both the organization of this cortical region during development and the functional activity and maintenance of the mature human hippocampal neurons.
12397373 The gene expression of protein was studied in the developing human tooth.
11790765 GDNF and NRTN are new neuromodulators that regulate the development of the neuromuscular synapse

AA Sequence

MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRALLQGAPDAMEL      1 - 70
RELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARV     71 - 140
YDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV                 141 - 197
//

Text Mined References (24)

PMID Year Title
24139947 2014 Immunohistological analysis of neurturin and its receptors in human cochlea.
24067900 2014 The neurotrophic factor neurturin contributes toward an aggressive cancer cell phenotype, neuropathic pain and neuronal plasticity in pancreatic cancer.
22847529 2013 Protection effect of GDNF and neurturin on photosensitized crayfish neurons and glial cells.
21723942 2011 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFR?2 isoforms.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
18970938 2008 Polymorphisms in the genes encoding the 4 RET ligands, GDNF, NTN, ARTN, PSPN, and susceptibility to Hirschsprung disease.
18222320 2008 Expression patterns of the glial cell line-derived neurotrophic factor, neurturin, their cognate receptors GFRalpha-1, GFRalpha-2, and a common signal transduction element c-Ret in the human skin hair follicles.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17522305 2007 Glial cell line-derived neurotrophic factor and neurturin inhibit neurite outgrowth and activate RhoA through GFR alpha 2b, an alternatively spliced isoform of GFR alpha 2.
16895582 2006 Glial cell-line derived neurotrophic factor and neurturin regulate the expressions of distinct miRNA precursors through the activation of GFRalpha2.
16081799 2005 Expression and function of glial cell line-derived neurotrophic factor family ligands and their receptors on human immune cells.
15829225 2005 Neurturin, persephin, and artemin in the human pre- and full-term newborn and adult hippocampus and fascia dentata.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15242795 2004 Neural cells in the esophagus respond to glial cell line-derived neurotrophic factor and neurturin, and are RET-dependent.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397373 2002 Expression patterns of neurotrophic factor mRNAs in developing human teeth.
11790765 2002 Regulation of neuromuscular synapse development by glial cell line-derived neurotrophic factor and neurturin.
10829012 2000 Binding of GDNF and neurturin to human GDNF family receptor alpha 1 and 2. Influence of cRET and cooperative interactions.
9700200 1998 Mutation of the RET ligand, neurturin, supports multigenic inheritance in Hirschsprung disease.
9407096 1997 GFRalpha-2 and GFRalpha-3 are two new receptors for ligands of the GDNF family.
9286710 1997 Neurturin, a novel neurotrophic factor, is localized to mouse chromosome 17 and human chromosome 19p13.3.
9192899 1997 Neurturin responsiveness requires a GPI-linked receptor and the Ret receptor tyrosine kinase.
9192898 1997 A GPI-linked protein that interacts with Ret to form a candidate neurturin receptor.
8945474 1996 Neurturin, a relative of glial-cell-line-derived neurotrophic factor.