Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.06
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2844 1.6e-31
osteosarcoma 7933 1.6e-04
group 3 medulloblastoma 2254 1.7e-03

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.093 1.6e-04
group 3 medulloblastoma -1.200 1.7e-03
lung carcinoma 1.600 1.6e-31

Synonym

Accession Q9GZP1 A8K3B2 Q6FII5 Q9NUD3
Symbols C20orf98
dJ1103G7.6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
26055238 Down regulated NRSN2 promotes cell proliferation and cell survival in hepatocellular liver cancer.
26045763 our findings suggest that NRSN2 promotes non-small cell lung cancer cell growth through PI3K/Akt/mTOR pathway
24019301 SOX12 and NRSN2 were identified as candidate genes that may be involved in the developmental defects in 20p13 microdeletion.
19824122 NRSN2 could be a tumor suppressor gene for hepatocellular carcinoma and a candidate biomarker for long-term survival in HCC

AA Sequence

MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGT      1 - 70
LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIG     71 - 140
WLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS          141 - 204
//

Text Mined References (16)

PMID Year Title
26055238 2015 Down-Regulated NRSN2 Promotes Cell Proliferation and Survival Through PI3K/Akt/mTOR Pathway in Hepatocellular Carcinoma.
26045763 2015 NRSN2 promotes non-small cell lung cancer cell growth through PI3K/Akt/mTOR pathway.
24019301 2013 SOX12 and NRSN2 are candidate genes for 20p13 subtelomeric deletions associated with developmental delay.
19824122 2009 Decreased expression of Neurensin-2 correlates with poor prognosis in hepatocellular carcinoma.
16527258 2006 Molecular characterization of a transport vesicle protein Neurensin-2, a homologue of Neurensin-1, expressed in neural cells.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.