Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.78
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.6e-31
osteosarcoma 7950 1.6e-04
group 3 medulloblastoma 4104 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.200 1.7e-03
lung carcinoma 1.600 1.6e-31
osteosarcoma 1.093 1.6e-04

Synonym

Accession Q9GZP1 A8K3B2 Q6FII5 Q9NUD3
Symbols C20orf98
dJ1103G7.6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGT      1 - 70
LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIG     71 - 140
WLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS          141 - 204
//

Text Mined References (17)

PMID Year Title