Property Summary

Ligand Count 1
NCBI Gene PubMed Count 240
PubMed Score 531.25
PubTator Score 453.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.200 6.4e-03
Astrocytoma, Pilocytic 1.300 6.3e-04
atypical teratoid / rhabdoid tumor 1.900 1.7e-05
cystic fibrosis 1.823 3.3e-06
ependymoma 1.600 4.2e-05
glioblastoma 1.200 4.3e-04
hereditary spastic paraplegia -1.264 1.2e-02
intraductal papillary-mucinous adenoma (... -1.100 4.3e-03
intraductal papillary-mucinous carcinoma... -2.700 6.3e-03
intraductal papillary-mucinous neoplasm ... -2.400 4.1e-02
invasive ductal carcinoma -1.100 2.0e-02
lung adenocarcinoma 1.400 1.2e-05
lung cancer -1.100 9.5e-04
lung carcinoma -1.400 2.0e-12
malignant mesothelioma -4.600 3.2e-08
medulloblastoma 1.700 1.1e-03
nasopharyngeal carcinoma 1.100 2.6e-02
osteosarcoma 1.524 3.0e-03
ovarian cancer -1.200 1.7e-02
primitive neuroectodermal tumor 1.300 4.7e-03
tuberculosis -3.200 9.7e-06
ulcerative colitis 2.000 1.5e-04

PDB (15)

Gene RIF (203)

AA Sequence

MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMIN      1 - 70
FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEI     71 - 140
FKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDR    141 - 210
LEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALG    211 - 280
MESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETK    281 - 350
KKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE    351 - 420
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLG    421 - 490
EEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTR    491 - 560
FIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATE    561 - 630
KPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADEN    631 - 700
QKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLL    701 - 770
HKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGD    771 - 840
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLK    841 - 910
KDKLNTQSTYSEA                                                             911 - 923
//

Text Mined References (247)

PMID Year Title