Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSMGRGGELETIC      1 - 70
RSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATAP     71 - 140
ALPMAPAPPLLAAALALAYLLRPLA                                                 141 - 165
//

Text Mined References (6)

PMID Year Title