Property Summary

NCBI Gene PubMed Count 15
PubMed Score 93.21
PubTator Score 18.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
nephrosclerosis 1.051 3.8e-02
malignant mesothelioma 6.400 9.2e-10
astrocytoma -4.000 2.7e-03
posterior fossa group A ependymoma -4.700 5.5e-14
oligodendroglioma -1.900 4.6e-11
psoriasis -1.900 1.8e-04
glioblastoma -3.000 3.4e-05
cystic fibrosis 3.067 7.0e-07
atypical teratoid / rhabdoid tumor -4.600 4.5e-09
primitive neuroectodermal tumor -2.500 7.0e-03
Duchenne muscular dystrophy 1.051 4.8e-06
autosomal dominant Emery-Dreifuss muscul... 1.039 8.3e-03
adrenocortical carcinoma 1.871 4.3e-02
intraductal papillary-mucinous neoplasm ... -1.300 2.1e-03
lung cancer -3.400 1.9e-05
Parkinson's disease -1.300 1.4e-02
breast carcinoma -1.600 1.8e-04
fibroadenoma -1.800 8.2e-03
interstitial cystitis 1.300 1.8e-03
lung adenocarcinoma -2.100 1.4e-17
pediatric high grade glioma -2.700 5.6e-05
pilocytic astrocytoma -4.300 8.8e-09
lung carcinoma -1.100 3.7e-05
non-small cell lung carcinoma -1.800 8.3e-25
Pick disease -1.300 2.8e-02
ductal carcinoma in situ -2.100 1.2e-03
invasive ductal carcinoma -3.500 6.2e-05
Breast cancer 1.300 2.0e-03
pituitary cancer -2.600 1.7e-05
Down syndrome -1.300 1.5e-03

Gene RIF (9)

PMID Text
26700405 (i) NRN1 variability is a shared risk factor for both schizophrenia-spectrum disorders (SSD) and bipolar disorders (BPD), (ii) NRN1 may have a selective impact on age at onset and intelligence in SSD.
26208391 Data indicate that neuritin not only plays an important role in the nervous system but also has an effect on the migration, senescence, proliferation, and viability of stem cells
25101829 Neuritin is reduced in the brains of Alzheimer's disease (AD) patients.
25036738 MiR-204 promotes apoptosis in oxidative stress-induced rat Schwann cells by suppressing neuritin expression
21652774 Data show that SMN and HuD form a complex in spinal motor axons, and that both interact with cpg15 mRNA in neurons.
20405246 we found neuritin is overexpressed in astrocytoma, which may be an important factor in tumorigenesis and progression of astrocytoma
19569075 NRN1 polymorphisms have roles in fluid intelligence in schizophrenia
18265009 CPG15 and CPG15-2 perform similar cellular functions but may play distinct roles in vivo through their cell-type- and tissue-specific transcriptional regulation
16723126 By Northern blot, we confirm hypoxia-induced expression of insulin-like growth factor binding protein 3 (igfbp3), thioredoxin-interacting protein (txnip), neuritin (nrn1).

AA Sequence

MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWE      1 - 70
DFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGSLLPAFPVLLVSLSAALATWL     71 - 140
SF                                                                        141 - 142
//

Text Mined References (15)

PMID Year Title
26700405 2016 Involvement of NRN1 gene in schizophrenia-spectrum and bipolar disorders and its impact on age at onset and cognitive functioning.
26208391 2015 Effects of neuritin on the migration, senescence and proliferation of human bone marrow mesenchymal stem cells.
25101829 2014 Neuritin attenuates cognitive function impairments in tg2576 mouse model of Alzheimer's disease.
25036738 2014 MiR-204 promotes apoptosis in oxidative stress-induced rat Schwann cells by suppressing neuritin expression.
21652774 2011 Interaction of survival of motor neuron (SMN) and HuD proteins with mRNA cpg15 rescues motor neuron axonal deficits.
20405246 2011 Neuritin expression and its relation with proliferation, apoptosis, and angiogenesis in human astrocytoma.
19569075 2010 Impact of Neuritin 1 (NRN1) polymorphisms on fluid intelligence in schizophrenia.
18265009 2008 cpg15 and cpg15-2 constitute a family of activity-regulated ligands expressed differentially in the nervous system to promote neurite growth and neuronal survival.
16723126 2006 Characterization of the expression of the hypoxia-induced genes neuritin, TXNIP and IGFBP3 in cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9122250 1997 Neuritin: a gene induced by neural activity and neurotrophins that promotes neuritogenesis.