Property Summary

NCBI Gene PubMed Count 35
PubMed Score 279.39
PubTator Score 110.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 3.600 1.8e-05
medulloblastoma, large-cell 1.500 4.7e-02

Gene RIF (20)

AA Sequence

MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLE      1 - 70
ELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSM     71 - 140
SVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLAR    141 - 210
ERDLYKARCDRLTSSGPGSGDPSHLFL                                               211 - 237
//

Text Mined References (38)

PMID Year Title