Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.00
PubTator Score 3.07

Knowledge Summary


No data available


  Differential Expression (6)

AA Sequence

KLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV                               1541 - 1582

Text Mined References (12)

PMID Year Title
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837278 2003 Cofilin phosphorylation and actin polymerization by NRK/NESK, a member of the germinal center kinase family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.