Property Summary

NCBI Gene PubMed Count 87
PubMed Score 183.76
PubTator Score 110.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.276 4.7e-05
aldosterone-producing adenoma -1.266 3.1e-02
Amyotrophic lateral sclerosis 1.306 2.2e-04
astrocytic glioma 2.300 1.4e-02
atypical teratoid / rhabdoid tumor -2.600 1.9e-05
Chronic Lymphocytic Leukemia -1.421 1.6e-02
Crohn's disease -1.215 7.4e-04
cystic fibrosis 1.052 1.4e-04
gastric cancer -1.400 4.3e-02
glioblastoma 1.200 3.5e-02
group 4 medulloblastoma 1.800 8.6e-03
hepatocellular carcinoma -1.200 6.1e-03
hereditary spastic paraplegia -1.229 4.3e-03
juvenile dermatomyositis 1.024 1.8e-04
lung cancer -3.000 5.3e-04
malignant mesothelioma -2.400 1.2e-08
medulloblastoma, large-cell 1.900 8.7e-04
oligodendroglioma 2.000 3.7e-02
osteosarcoma 3.403 6.3e-08
ovarian cancer 1.500 5.7e-04
pediatric high grade glioma 1.400 9.5e-03
Pick disease 1.700 1.9e-05
primitive neuroectodermal tumor 1.400 7.4e-03
Rheumatoid arthritis 3.600 1.2e-04
sarcoidosis 1.500 4.6e-02
ulcerative colitis -1.485 5.4e-03
Waldenstrons macroglobulinemia -1.727 1.6e-02

Gene RIF (48)

AA Sequence

MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHNEEDQNFNISGSAFPTCQSNGPVLNT      1 - 70
HTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIMNLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSF     71 - 140
SSRLQTVALSQQIRQSLKEQGYALSHDSLKVEKDLRCYGVASSHLKTLLKKSKVKDQKPDTNLPDVTKNL    141 - 210
IRDRFAESPHHVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYS    211 - 280
REHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPM    281 - 350
GIIPSSPKNAGYKNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDEYSDN    351 - 420
NPSFTDDSSGDESSYSNCVPIDLSCKHRTEKSESDQPVSLDNFTQSLLNTWDPKVPDVDIKEDQDTSKNS    421 - 490
KLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVHNDVSKFNTQNYARTSVIESPSTNRTTPVSTPPLLTSS    491 - 560
KAGSPINLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSMDLTKSKDPPGEKPAQNEGAQNSATFSASKL    561 - 630
LQNLAQCGMQSSMSVEEQRPSKQLLTGNTDKPIGMIDRLNSPLLSNKTNAVEENKAFSSQPTGPEPGLSG    631 - 700
SEIENLLERRTVLQLLLGNPNKGKSEKKEKTPLRDESTQEHSERALSEQILMVKIKSEPCDDLQIPNTNV    701 - 770
HLSHDAKSAPFLGMAPAVQRSAPALPVSEDFKSEPVSPQDFSFSKNGLLSRLLRQNQDSYLADDSDRSHR    771 - 840
NNEMALLESKNLCMVPKKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEELKFSRNDLEFK    841 - 910
YPAGHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVADSKKKGHKNNVTNSKPEFSISS    911 - 980
LNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLLNGCSMPSEKGPIKWVITDAE    981 - 1050
KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFN   1051 - 1120
LRSPYNSHMGNNASRPHSANGEVYGLLGSVLTIKKESE                                   1121 - 1158
//

Text Mined References (92)

PMID Year Title