Property Summary

NCBI Gene PubMed Count 39
PubMed Score 268.45
PubTator Score 132.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
pancreatic cancer 1.200 2.2e-02
astrocytoma -4.600 4.4e-03
posterior fossa group B ependymoma -4.700 3.0e-10
glioblastoma -4.300 3.9e-05
oligodendroglioma -3.200 3.2e-15
medulloblastoma -4.600 6.5e-07
atypical teratoid / rhabdoid tumor -3.900 4.0e-06
medulloblastoma, large-cell -4.000 7.3e-03
primitive neuroectodermal tumor -4.100 1.5e-03
non-small cell lung cancer -2.072 1.6e-17
lung cancer -1.100 2.6e-02
interstitial cystitis 1.100 4.7e-03
pediatric high grade glioma -2.900 1.5e-03
pilocytic astrocytoma -4.100 1.5e-05
pancreatic carcinoma 1.200 2.2e-02
Pick disease -1.600 1.4e-02

Synonym

Accession Q92686 Ng
Symbols RC3
hng

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (27)

PMID Text
26828755 Polymorphisms in NRGN are associated with schizophrenia, major depressive disorder and bipolar disorder in the Han Chinese population.
26826204 These results confirm an increase in CSF Ng concentration in patients with AD as previously reported and show that this is specific to AD and not seen in a range of other neurodegenerative diseases.
26698298 Neurogranin and YKL-40 are promising AD biomarkers, independent of and complementary to the established core Alzheimer's disease (AD) biomarkers, reflecting additional pathological changes in the course of AD
26373605 Cerebrospinal fluid neurogranin was increased in patients with Alzheimer's dementia, progressive mild cognitive impairment (MCI) and stable MCI compared with controls, and in Alzheimer's dementia and progressive MCI compared with stable MCI.
26366630 Within-person levels of NGRN increased in cognitively normal participants but not in patients with later stage mild cognitive impairment or Alzhiemer's disease; NGRN may reflect presymptomatic synaptic dysfunction or loss.
26025774 This report provides evidence to support larger and controlled traumatic brain injury clinical studies for NRGN validation and prediction of outcomes.
25446004 neurogranin binds to alpha-synuclein in the human cortex, and this interaction decreases in Parkinson's disease along with the phosphorylation of neurogranin, a molecular process thought to be involved in learning and memory
24713697 Data indicate that neurogranin makes contacts with both the N- and C-domains of calmodulin that functionally leads to altered calcium binding kinetics.
24386483 These findings help to clarify underlying NRGN mediated pathophysiological mechanisms involving cortical-subcortical brain networks in schizophrenia.
24098564 NRGN risk variants contribute to subtle changes in neural functioning and anatomy.
23903071 Our results support an association between the NRGN gene and schizophrenia and a hypothesis that the NRGN gene may mediate the risk associated with schizophrenia via intellectual dysfunction.
22856365 single nucleotide polymorphism located upstream of the neurogranin (NRGN) gene has been identified as a risk variant for schizophrenia.
22461181 This study provides further evidence of the association of the NRGN gene with schizophrenia.
22306195 This study demonistrated that multiple rare mutations in schizophrenia, and provides genetic clues that indicate the involvement of NRGN in this disorder.
22253779 The genome-wide associated genetic risk variant in the NRGN gene may be related to a small gray matter volume in the anterior cingulate cortex in the left hemisphere in patients with schizophrenia.
21799211 The influence of NRGN genotype on the neural correlates of memory encoding and retrieval is manifest in the cingulate cortex and is involved in hippocampal formation.
21647148 Hippocampal activation diminished during the acquisition of contextual fear in healthy carriers of the genome-wide-supported risk variant for schizophrenia, rs12807809 in neurogranin.
21538840 our study provides strong evidence that common exonic variation does not account for the genome-wide signi fi cant association between schizophrenia and variation at NRGN
21112188 No association between the schizophrenia associated NRGN variant rs12807809 and cognition could be detected in these samples.
21037240 Observational study of gene-disease association. (HuGE Navigator)
20875798 Elevated cerebrospinal fluid neurogranin levels together with Alzheimer disease biomarkers may reflect synaptic degeneration.
19571808 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18855024 Data suggest that BSX is essential for global cognitive function and that haplo-insufficiency may cause severe mental retardation, and that deletion of Neurogranin contributes to the auditory attention deficit observed in most 11q- patients.
17140601 Observational study of gene-disease association. (HuGE Navigator)
17140601 Genotype distribution showed association of the rs7113041 SNP with schizophrenia in males of Portuguese origin, which was confirmed by the analysis of the proband-parent triads.
16677608 Nevertheless, by gel shift assays, Sp1 and Sp3 were not found to be responsible for the protein-DNA complexes formed by the GC-rich sequence.
12808095 IL-2 deprivation raises the level of RC3 and other apoptotic factors, which induce apoptosis by increasing the intracellular Ca(2+) concentration

AA Sequence

MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG      1 - 70
AGGGPSGD                                                                   71 - 78
//

Text Mined References (44)

PMID Year Title
26828755 2016 Polymorphisms in NRGN are associated with schizophrenia, major depressive disorder and bipolar disorder in the Han Chinese population.
26826204 2016 Increased CSF neurogranin concentration is specific to Alzheimer disease.
26698298 2015 Neurogranin and YKL-40: independent markers of synaptic degeneration and neuroinflammation in Alzheimer's disease.
26373605 2015 Cerebrospinal fluid neurogranin: relation to cognition and neurodegeneration in Alzheimer's disease.
26366630 2015 Neurogranin as a Cerebrospinal Fluid Biomarker for Synaptic Loss in Symptomatic Alzheimer Disease.
26025774 2015 Serum neurogranin measurement as a biomarker of acute traumatic brain injury.
25446004 2014 Neurogranin binds ?-synuclein in the human superior temporal cortex and interaction is decreased in Parkinson's disease.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24713697 2014 Neurogranin alters the structure and calcium binding properties of calmodulin.
24386483 2013 Effects of the neurogranin variant rs12807809 on thalamocortical morphology in schizophrenia.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24098564 2013 The impact of genome-wide supported schizophrenia risk variants in the neurogranin gene on brain structure and function.
23903071 2013 Influence of the NRGN gene on intellectual ability in schizophrenia.
23828821 2013 Identification and characterization of citrulline-modified brain proteins by combining HCD and CID fragmentation.
22856365 2012 The effect of the neurogranin schizophrenia risk variant rs12807809 on brain structure and function.
22461181 2012 Functional genetic variation at the NRGN gene and schizophrenia: evidence from a gene-based case-control study and gene expression analysis.
22306195 2012 Genetic and functional analysis of the gene encoding neurogranin in schizophrenia.
22253779 2012 Impact of the genome wide supported NRGN gene on anterior cingulate morphology in schizophrenia.
21799211 2013 The effect of neurogranin on neural correlates of episodic memory encoding and retrieval.
21647148 2011 Risk variant for schizophrenia in the neurogranin gene impacts on hippocampus activation during contextual fear conditioning.
21538840 2011 Analysis of neurogranin (NRGN) in schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
21112188 2011 A neuropsychological investigation of the genome wide associated schizophrenia risk variant NRGN rs12807809.
21037240 2011 Most genome-wide significant susceptibility loci for schizophrenia and bipolar disorder reported to date cross-traditional diagnostic boundaries.
20875798 2010 Neurogranin in cerebrospinal fluid as a marker of synaptic degeneration in Alzheimer's disease.
19571808 2009 Common variants conferring risk of schizophrenia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18855024 2009 Chromosomal microarray mapping suggests a role for BSX and Neurogranin in neurocognitive and behavioral defects in the 11q terminal deletion disorder (Jacobsen syndrome).
17244347 2007 Pathways and genes differentially expressed in the motor cortex of patients with sporadic amyotrophic lateral sclerosis.
17140601 2008 Association of the gene encoding neurogranin with schizophrenia in males.
16677608 2006 Involvement of the GC-rich sequence and specific proteins (Sp1/Sp3) in the basal transcription activity of neurogranin gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12889141 2003 [Neurogranin: a brain-specific protein].
12808095 2003 Transcriptional program of apoptosis induction following interleukin 2 deprivation: identification of RC3, a calcium/calmodulin binding protein, as a novel proapoptotic factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11060308 2001 Glutathiolation of proteins by glutathione disulfide S-oxide derived from S-nitrosoglutathione. Modifications of rat brain neurogranin/RC3 and neuromodulin/GAP-43.
10075657 1999 Interactions between neurogranin and calmodulin in vivo.
9886843 1999 The human RC3 gene homolog, NRGN contains a thyroid hormone-responsive element located in the first intron.
9499372 1997 [Structure and chromosomal localization of human neurogranin gene].
9329454 1997 Dendritic translocation of RC3/neurogranin mRNA in normal aging, Alzheimer disease and fronto-temporal dementia.
9143500 1997 Structure, organization, and chromosomal mapping of the human neurogranin gene (NRGN).
8929222 1996 [Cloning cDNA for human neurogranin].
8080473 1993 Characterization of a 7.5-kDa protein kinase C substrate (RC3 protein, neurogranin) from rat brain.
7898318 1994 Localization of RC3 (neurogranin) in rat brain subcellular fractions.