Property Summary

NCBI Gene PubMed Count 37
PubMed Score 35.87
PubTator Score 37.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 4.0e-09
glioblastoma -2.300 4.1e-04
oligodendroglioma -1.300 8.3e-10
group 4 medulloblastoma -2.600 2.7e-06
atypical teratoid / rhabdoid tumor -2.600 1.7e-04
medulloblastoma, large-cell -2.000 1.6e-03
primitive neuroectodermal tumor -2.100 3.5e-03
adult high grade glioma -2.300 4.9e-04
pilocytic astrocytoma -1.200 1.9e-03
psoriasis -1.900 5.4e-41

Gene RIF (28)

PMID Text
24431462 An association between rs10748842 genotype in neuregulin 3 does not fit a simple inefficiency model of risk association in dorsolateral prefrontal cortex physiology.
24061483 This study demonstrated that genetic variants in the NRG3 gene play a role in alzheimer disease and revealed that SNPs in the NRG3 genes were more strongly associated with onset age of Alzherimer disease.
23999525 these data suggest that Nrg3/ErbB4 signaling may be an important factor in nicotine dependence.
23315268 NRG3 may be a susceptibility gene for Hirschsprung's disease in a Chinese population.
22981155 no association of SNPs or haplotypes with risk of schizophrenia in Han Chinese population
22831755 Neuregulin 3 rs6584400 genetic carriers are associated with psychotic symptoms and attention performance in schizophrenia.
22589734 Our results suggest a role for NRG3 in HSCR etiology and provide insights into the relative contribution of structural variants in both syndromic and non-syndromic HSCR.
21762460 NRG3 polymorphisms and haplotypes were similar between schizophrenia patients and healthy controls of Korean ethnicity
21705454 Data show that rs1649942, which is located in the intron region of NM_001165973.1. (NRG3 neuregulin 3), was associated with poorer overall survival in women with optimally debulked tumors.
20713722 Data show that NRG3 is a schizophrenia susceptibility gene, provide quantitative insight into NRG3 transcription traits in the brain, and reveal a probable mechanistic basis for disease association.
20713722 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20548296 Results suggest that NRG3 may be modulating early attentional processes for perceptual sensitivity and vigilance, with opposite effects in affected individuals and healthy controls.
20548296 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19776380 Observational study of gene-disease association. (HuGE Navigator)
19118813 NRG3 is primarily expressed in the central nervous system and is one of three paralogs of NRG1, a gene strongly implicated in SZ.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18846501 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18708184 The result of tis study supports that the NRG3 gene is a susceptibility gene for schizophrenia.
18708184 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17962208 NRG3 was expressed in 42% of breast cancers studied. It was preferentially expressed in breast tumors co-expressing EGFR/HER4.
17880691 In transgenic female mice, Nrg3 has a role in the initiation of mammary placodes along the body axis; alterations in morphogenesis and differentiation of other epidermal appendages are also observed, including the hair follicles.
17598910 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16478787 The NRG3 protein is a new post-translationally regulated isoform of neuregulin 3 expressed in the developing human central nervous system with a role in oligodendrocyte survival.

AA Sequence

MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVV      1 - 70
PLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATP     71 - 140
SAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRP    141 - 210
PVPGTPSTQAMPSWPTAAYATSSYLHDSTPSWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYS    211 - 280
TERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEF    281 - 350
MESEEVYQRQVLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV    351 - 420
KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPGQRSGMLHRNA    421 - 490
FRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPIQLWCVERPLDLKYSSSGLKT    491 - 560
QRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQMPGISEVKSIKWCKNSYS    561 - 630
ADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKS    631 - 700
EREAQFVLRNEIQRDSALTK                                                      701 - 720
//

Text Mined References (38)

PMID Year Title
24431462 2014 Effects of neuregulin 3 genotype on human prefrontal cortex physiology.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24061483 2014 NRG3 gene is associated with the risk and age at onset of Alzheimer disease.
23999525 2014 Evidence from mouse and man for a role of neuregulin 3 in nicotine dependence.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23315268 2013 Exome sequencing identified NRG3 as a novel susceptible gene of Hirschsprung's disease in a Chinese population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22981155 2013 No genetic evidence for Neuregulin 3 conferring risk of schizophrenia in the Chinese population.
22831755 2013 Neuregulin 3 is associated with attention deficits in schizophrenia and bipolar disorder.
22589734 2012 Genome-wide copy number analysis uncovers a new HSCR gene: NRG3.
21762460 2011 Neuregulin 3 does not confer risk for schizophrenia and smooth pursuit eye movement abnormality in a Korean population.
21705454 2011 Platinum sensitivity-related germline polymorphism discovered via a cell-based approach and analysis of its association with outcome in ovarian cancer patients.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
20713722 2010 Common genetic variation in Neuregulin 3 (NRG3) influences risk for schizophrenia and impacts NRG3 expression in human brain.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20548296 2011 Neuregulin 3 (NRG3) as a susceptibility gene in a schizophrenia subtype with florid delusions and relatively spared cognition.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19776380 2009 Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP.
19118813 2009 Fine mapping on chromosome 10q22-q23 implicates Neuregulin 3 in schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18846501 2008 Does parental expressed emotion moderate genetic effects in ADHD? An exploration using a genome wide association scan.
18708184 2008 Neuregulin 3 genetic variations and susceptibility to schizophrenia in a Chinese population.
18521091 2009 Whole genome association study identifies polymorphisms associated with QT prolongation during iloperidone treatment of schizophrenia.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17962208 2008 ErbB/HER ligands in human breast cancer, and relationships with their receptors, the bio-pathological features and prognosis.
17880691 2007 Neuregulin3 alters cell fate in the epidermis and mammary gland.
17598910 2007 Interactions among genes in the ErbB-Neuregulin signalling network are associated with increased susceptibility to schizophrenia.
16478787 2006 Characterization of a neural-specific splicing form of the human neuregulin 3 gene involved in oligodendrocyte survival.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11032326 2000 Human NRG3 gene Map position 10q22-q23.
10867024 2000 Ligand discrimination in signaling through an ErbB4 receptor homodimer.
9275162 1997 Neuregulin-3 (NRG3): a novel neural tissue-enriched protein that binds and activates ErbB4.