Property Summary

NCBI Gene PubMed Count 431
PubMed Score 922.43
PubTator Score 761.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 5.93517935373231E-5
Disease Target Count
Hirschsprung's disease 46

Expression

  Differential Expression (22)

Disease log2 FC p
lung cancer -2.400 5.9e-05
adult high grade glioma -2.100 1.9e-04
astrocytic glioma -2.000 2.7e-03
Astrocytoma, Pilocytic -2.900 2.7e-08
atypical teratoid / rhabdoid tumor 1.100 2.6e-02
Breast cancer -2.800 4.4e-57
colon cancer -1.200 2.7e-02
ependymoma -2.000 6.0e-03
glioblastoma -2.400 1.6e-06
group 4 medulloblastoma -2.200 1.6e-04
interstitial cystitis 1.800 7.9e-03
lung adenocarcinoma -1.400 4.4e-12
malignant mesothelioma 2.000 2.3e-07
medulloblastoma, large-cell -2.000 2.0e-02
nephrosclerosis -1.036 3.9e-02
oligodendroglioma -1.500 9.1e-03
osteosarcoma -1.817 3.8e-06
pancreatic cancer 1.100 2.3e-02
pancreatic carcinoma 1.100 2.3e-02
pituitary cancer 1.100 9.2e-05
tuberculosis 1.800 6.4e-05
type II diabetes mellitus and post-ische... 1.200 2.8e-02

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (419)

AA Sequence

MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKW      1 - 70
FKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMP     71 - 140
ASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLC    141 - 210
KCQPGFTGARCTENVPMKVQNQEKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQ    211 - 280
SLRSERNNMMNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQT    281 - 350
PSHSWSNGHTESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH    351 - 420
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFMEEERPLLLVTPPRLREKK    421 - 490
FDHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYEPAQEPVKKLANSRRAKRTKPNGHIANRL    491 - 560
EVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLEATPAFRLADSRTNPAGRFSTQEEIQARLSS    561 - 630
VIANQDPIAV                                                                631 - 640
//

Text Mined References (434)

PMID Year Title