Property Summary

NCBI Gene PubMed Count 81
PubMed Score 256.46
PubTator Score 175.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.900 9.1e-03
ependymoma 2.000 1.4e-02
oligodendroglioma 1.500 1.6e-02
psoriasis -1.900 5.7e-05
osteosarcoma -2.887 1.1e-09
intraductal papillary-mucinous adenoma (... 1.100 7.3e-04
intraductal papillary-mucinous carcinoma... 1.600 5.8e-03
intraductal papillary-mucinous neoplasm ... 1.400 5.9e-03
Pick disease 1.100 1.4e-02

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (54)

PMID Text
26492917 EglN2 associates with the NRF1-PGC1alpha complex and controls mitochondrial function in breast cancer
26268886 Importantly, Nrf1 activity is positively and/or negatively regulated by distinct doses of proteasome and calpain inhibitors
26254094 This review outlines Nrf1 structure, function, regulation and its links to insulin resistance, diabetes and inflammation.
26201446 Low NRF1 expression was associated lymphatic metastasis and radio-resistance in nasopharyngeal carcinoma.
25976310 Lack of aprataxin impairs mitochondrial functions via downregulation of the APE1/NRF1/NRF2 pathway.
25965299 Results present evidence in the support of E2-induced ROS-mediated AKT signalling leading to the activation of NRF-1-regulated cell cycle genes.
25959814 We show that composite nucleosomes containing mH2A and NRF-1 are stably positioned on gene regulatory regions and can buffer transcriptional noise associated with antiviral responses
25792330 This study identified a regulatory branch of the mitochondrial unfolded protein response (UPR(mt)), which is mediated by the interplay of SIRT7 and NRF1 and is coupled to cellular energy metabolism and proliferation.
25637874 The results indicate that Nrf1 is a transcriptional activator of Herpud1 expression during ER stress, and they suggest Nrf1 is a key player in the regulation of the ER stress response in cells.
25130429 The treatment with E2, Res, or VC significantly increased mRNA and protein expression levels of Nrf1.
24875355 The mitochondria targeting sequence-deficient hTFAM also repressed Tfam promoter activity to the same degree as hTFAM.
24466341 Nrf1 physically interacts with androgen receptor and enhances it's DNA-binding activity, suggesting that the p65-Nrf1 isoform is a potential androgen receptor coactivator.
24462598 while Nrf2 is crucial for MRE/ARE-mediated transcription in response to copper, Nrf1 may activate MT-1 expression by a mechanism different from that Nrf2 employs.
24204994 Low NRF1 expression is associated with chronic kidney disease after dialysis.
24024152 Nrf1 knockout resulted in the increased expression of GCLC and GCLM in human bronchial epithelial (HBE1) cells.
23939472 We verified that NRF-1 positively regulates FAM134C and ENOX1, and negatively regulates C3orf10 in human neuroblastoma IMR-32 cells and primary rat cortical neurons.
23144760 Data indicate both Nrf1a and Nrf1b isoforms transcripts were detected in different mouse and human cell lines, and in various mouse tissues.
23048038 NRF-1 regulates Atp1a1 and Atp1b1 and are important in mediating the energy generation and neuronal activity.
22580151 APE1 is a new coactivator of NRF1, demonstrating an additional regulatory role of APE1 in maintenance of mitochondrial functionality.
22500024 results indicate a novel role of Nrf1 in UVB-induced DNA damage repair and suggest Nrf1 as a tumor suppressor in the skin
22105178 Given that NRF-1 is a key nuclear transcription factor regulating genes involved in mitochondrial activity and biogenesis, these data suggest that diesel exhaust particulate extracts may adversely affect mitochondrial function.
21953459 Fbw7 as a regulator of Nrf1 expression and reveal a novel function of Fbw7 in cellular stress response.
21609478 Both NRF-1 and GABP have been linked to the regulation of nuclear-encoded mitochondrial proteins, and the results of this study suggest their expression is coordinated by NRF-1's activation of the GABPbeta promoter.
21486948 Upon IMS stress, overproduction of reactive oxygen species (ROS) and phosphorylation of AKT triggers estrogen receptor (ER) activity, which further upregulates the transcription of the mitochondrial regulator NRF1 and the IMS protease HTRA2.
21447778 Single nucleotide polymorphism in NRF1 gene is associated with epithelial ovarian cancer.
21146886 Data demonstrated that the polymorphism in TP53 (rs1042522) was associated with type 2 diabetes, and that potential interaction of TP53 (rs1042522) and RAPGEF1 (rs11243444), or NRF1 (rs1882095) increased the risk of type 2 diabetes.
20724482 the obligatory intestinal folate transporter PCFT (SLC46A1) is regulated by nuclear respiratory factor 1
20629635 Data show that Nrf1 can adopt several topologies within membranes that are determined by its NTD.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20599696 This study demonstrates that NRF-1 is a novel transcriptional inhibitor of the human ACCbeta gene promoter in the mammalian heart.
20587593 Findings indicate that TLR4-dependent NFkappaB and CREB activation co-regulate the NRF1 promoter with NFkappaB intronic enhancement and redox-regulated nuclear translocation, leading to downstream target-gene expression.
20561910 Taken together, these results confirm the direct interaction of NRF-1 and ERR alpha with PGC-1 beta, and their participation in mitochondrial biogenesis and respiration.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19674972 Deletion and site-directed mutagenesis combined with in silico transcription factor binding analysis of VSNL1 promoter identified nuclear respiratory factor (NRF)-1/alpha-PAL as a major player in regulating VSNL1 minimal promoter activity.
19460752 Knockdown of nuclear respiratory factor 1 (NRF1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19453261 Observational study of gene-disease association. (HuGE Navigator)
19181665 NRF-1 can also directly interact with poly(ADP-ribose) polymerase 1 (PARP-1) and co-purify the PARP-1.DNA-PK.Ku80.Ku70.topoisomerase IIbeta-containing protein complex.
18719883 No differences in mRNA levels of genes which mediate the transcriptional of mitochondrial biogenesis (PPARGC1A and NRF1) or in mitochondrial mass between diabetic and control myotubes.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18364745 Data show that NRF-1 is the main transcription factor regulating the expression of TOMM34, and that Sp1 interacts with NRF-1 to stimulate the promoter's full activity.
18234454 results reveal that especially NRF-1, along with AP-1 and, to a minor extent, an Sp1 site, is essential for human CAPNS1 promoter activity and gene expression
18222924 These findings support a role for MEF2A as an intermediary in coordinating respiratory chain subunit expression in heart and muscle through a NRF1 --> MEF2A --> COX(H) transcriptional cascade.
18184751 There is an association between NRF-1 genotypes (rs2402970 and rs6949152 polymorphisms) and the baseline and/or training response of human aerobic capacity.
18184751 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18071027 Observational study of gene-disease association. (HuGE Navigator)
16082529 Observational study of gene-disease association. (HuGE Navigator)
15992771 These findings indicate that a novel function of alpha-Pal/NRF-1 is to regulate neuronal differentiation, and that this function is mediated partly via its downstream IAP gene.
15452206 specifically binds the 21-bp minimal promoter and positively contributes to transcription of the X gene of Hepatitis B virus.
14747477 alpha-Pal/NRF-1 is an essential transcription factor in the regulation of human IAP gene expression
12958173 Overexpression of human nuclear respiratory factor 1 in transgenic mice increases glucose transport capacity in skeletal muscle.
12832613 Insulin resistance and DM associate with reduced expression of multiple nuclear respiratory factor-1 (NRF-1)-dependent genes encoding key enzymes in oxidative metabolism and mitochondrial function
12174908 Effect of gene on proliferation arrest in a non-small cell bronchopulmonary cancer line.
8034649 Fig 2B describes a putative bZIP motif; however, this peptide sequence has no sequence similarity to the conserved smart00338:BRLZ or pfam03131:bZIP_Maf protein domains.
7558044 The authors incorrectly use the symbol NFE2L1; this publication discusses nuclear respiratory factor 1 which has an official symbol of NRF1.

AA Sequence

MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAH      1 - 70
LAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKP     71 - 140
NPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIP    141 - 210
EMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLY    211 - 280
AFEDQQTQTQATATHSIAHLVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSA    281 - 350
VADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE    351 - 420
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVT    421 - 490
MDGQAVEVVTLEQ                                                             491 - 503
//

Text Mined References (87)

PMID Year Title
26492917 2015 EglN2 associates with the NRF1-PGC1? complex and controls mitochondrial function in breast cancer.
26268886 2015 The selective post-translational processing of transcription factor Nrf1 yields distinct isoforms that dictate its ability to differentially regulate gene expression.
26254094 2015 Changing gears in Nrf1 research, from mechanisms of regulation to its role in disease and prevention.
26201446 2015 miR-504 mediated down-regulation of nuclear respiratory factor 1 leads to radio-resistance in nasopharyngeal carcinoma.
25976310 2015 Lack of aprataxin impairs mitochondrial functions via downregulation of the APE1/NRF1/NRF2 pathway.
25965299 2015 Redox signalling to nuclear regulatory proteins by reactive oxygen species contributes to oestrogen-induced growth of breast cancer cells.
25959814 2015 Composite macroH2A/NRF-1 Nucleosomes Suppress Noise and Generate Robustness in Gene Expression.
25792330 2015 Stem cell aging. A mitochondrial UPR-mediated metabolic checkpoint regulates hematopoietic stem cell aging.
25637874 2015 Induction of Herpud1 expression by ER stress is regulated by Nrf1.
25416956 2014 A proteome-scale map of the human interactome network.
25130429 2014 Natural antioxidants exhibit chemopreventive characteristics through the regulation of CNC b-Zip transcription factors in estrogen-induced breast carcinogenesis.
24875355 2014 Negative transcriptional regulation of mitochondrial transcription factor A (TFAM) by nuclear TFAM.
24466341 2014 Nrf1 and Nrf2 transcription factors regulate androgen receptor transactivation in prostate cancer cells.
24462598 2014 The role of Nrf1 and Nrf2 in the regulation of copper-responsive transcription.
24204994 2013 Downregulation of nuclear-encoded genes of oxidative metabolism in dialyzed chronic kidney disease patients.
24024152 2013 Competition of nuclear factor-erythroid 2 factors related transcription factor isoforms, Nrf1 and Nrf2, in antioxidant enzyme induction.
23939472 2013 Novel genes FAM134C, C3orf10 and ENOX1 are regulated by NRF-1 and differentially regulate neurite outgrowth in neuroblastoma cells and hippocampal neurons.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23144760 2012 Characterization of Nrf1b, a novel isoform of the nuclear factor-erythroid-2 related transcription factor-1 that activates antioxidant response element-regulated genes.
23048038 2012 Regulation of Na(+)/K(+)-ATPase by nuclear respiratory factor 1: implication in the tight coupling of neuronal activity, energy generation, and energy consumption.
22580151 2012 Human AP endonuclease/redox factor APE1/ref-1 modulates mitochondrial function after oxidative stress by regulating the transcriptional activity of NRF1.
22500024 2012 Nrf1 CNC-bZIP protein promotes cell survival and nucleotide excision repair through maintaining glutathione homeostasis.
22105178 2012 Diesel exhaust particulate extracts inhibit transcription of nuclear respiratory factor-1 and cell viability in human umbilical vein endothelial cells.
21953459 2011 The Fbw7 tumor suppressor regulates nuclear factor E2-related factor 1 transcription factor turnover through proteasome-mediated proteolysis.
21609478 2011 Decreased expression of BRCA1 in SK-BR-3 cells is the result of aberrant activation of the GABP Beta promoter by an NRF-1-containing complex.
21486948 2011 Estrogen receptor mediates a distinct mitochondrial unfolded protein response.
21447778 2011 Inherited variants in mitochondrial biogenesis genes may influence epithelial ovarian cancer risk.
21269460 2011 Initial characterization of the human central proteome.
21146886 2011 Association between polymorphisms in RAPGEF1, TP53, NRF1 and type 2 diabetes in Chinese Han population.
20724482 2010 The obligatory intestinal folate transporter PCFT (SLC46A1) is regulated by nuclear respiratory factor 1.
20629635 2010 Identification of topological determinants in the N-terminal domain of transcription factor Nrf1 that control its orientation in the endoplasmic reticulum membrane.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20599696 2010 AMPK activation represses the human gene promoter of the cardiac isoform of acetyl-CoA carboxylase: Role of nuclear respiratory factor-1.
20587593 2010 Co-regulation of nuclear respiratory factor-1 by NFkappaB and CREB links LPS-induced inflammation to mitochondrial biogenesis.
20561910 2010 PGC-1 beta-regulated mitochondrial biogenesis and function in myotubes is mediated by NRF-1 and ERR alpha.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19674972 2009 Promoter regulation of the visinin-like subfamily of neuronal calcium sensor proteins by nuclear respiratory factor-1.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19181665 2009 Poly(ADP-ribose) Polymerase 1 Interacts with Nuclear Respiratory Factor 1 (NRF-1) and Plays a Role in NRF-1 Transcriptional Regulation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18719883 2008 Transcriptional profiling of myotubes from patients with type 2 diabetes: no evidence for a primary defect in oxidative phosphorylation genes.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18364745 2008 NRF-1 is the major transcription factor regulating the expression of the human TOMM34 gene.
18234454 2008 NRF-1, and AP-1 regulate the promoter of the human calpain small subunit 1 (CAPNS1) gene.
18222924 2008 Nuclear respiratory factor 1 controls myocyte enhancer factor 2A transcription to provide a mechanism for coordinate expression of respiratory chain subunits.
18184751 2008 NRF-1 genotypes and endurance exercise capacity in young Chinese men.
18071027 2008 Genetic variation and association analyses of the nuclear respiratory factor 1 (nRF1) gene in Chinese patients with type 2 diabetes.
16908542 2006 PGC-1-related coactivator: immediate early expression and characterization of a CREB/NRF-1 binding domain associated with cytochrome c promoter occupancy and respiratory growth.
16082529 2005 Association between polymorphisms in the nuclear respiratory factor 1 gene and type 2 diabetes mellitus in the Korean population.
15992771 2005 A novel function of transcription factor alpha-Pal/NRF-1: increasing neurite outgrowth.
15684387 2005 Control of mitochondrial transcription specificity factors (TFB1M and TFB2M) by nuclear respiratory factors (NRF-1 and NRF-2) and PGC-1 family coactivators.
15656981 2005 Dual promoter structure of ZFP106: regulation by myogenin and nuclear respiratory factor-1.
15525513 2004 A common set of gene regulatory networks links metabolism and growth inhibition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479157 2005 The roles of Sp1, Sp3, USF1/USF2 and NRF-1 in the regulation and three-dimensional structure of the Fragile X mental retardation gene promoter.
15452206 2004 Nuclear respiratory factor 1 plays an essential role in transcriptional initiation from the hepatitis B virus x gene promoter.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15257658 2004 The NRF-1/alpha-PAL transcription factor regulates human E2F6 promoter activity.
15126285 2004 Regulation of mitochondrial transcription factor A expression by high glucose.
14962666 2004 Imprinting analysis of 10 genes and/or transcripts in a 1.5-Mb MEST-flanking region at human chromosome 7q32.
14747477 2004 Alpha-Pal/NRF-1 regulates the promoter of the human integrin-associated protein/CD47 gene.
14715254 2004 In vitro methylation of nuclear respiratory factor-1 binding site suppresses the promoter activity of mitochondrial transcription factor A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12958173 2003 Skeletal muscle overexpression of nuclear respiratory factor 1 increases glucose transport capacity.
12853948 2003 The DNA sequence of human chromosome 7.
12832613 2003 Coordinated reduction of genes of oxidative metabolism in humans with insulin resistance and diabetes: Potential role of PGC1 and NRF1.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943463 2002 Transcriptional activators and coactivators in the nuclear control of mitochondrial function in mammalian cells.
11457459 2001 Increased expression of mitochondrial transcription factor A and nuclear respiratory factor-1 in skeletal muscle from aged human subjects.
11340167 2001 Pgc-1-related coactivator, a novel, serum-inducible coactivator of nuclear respiratory factor 1-dependent transcription in mammalian cells.
11069771 2000 Dynein light chain interacts with NRF-1 and EWG, structurally and functionally related transcription factors from humans and drosophila.
11058604 2001 Interaction of the transcription factors USF1, USF2, and alpha -Pal/Nrf-1 with the FMR1 promoter. Implications for Fragile X mental retardation syndrome.
10777530 2000 Identification of a nuclear respiratory factor-1 binding site within the core promoter of the human polio virus receptor/CD155 gene.
10412986 1999 Mechanisms controlling mitochondrial biogenesis and respiration through the thermogenic coactivator PGC-1.
10364186 1999 Respiratory uncoupling induces delta-aminolevulinate synthase expression through a nuclear respiratory factor-1-dependent mechanism in HeLa cells.
10222232 1999 Oxidative stress and upregulation of mitochondrial biogenesis genes in mitochondrial DNA-depleted HeLa cells.
9492280 1998 Promoter analysis of the human succinate dehydrogenase iron-protein gene--both nuclear respiratory factors NRF-1 and NRF-2 are required.
9228045 1997 Serine phosphorylation within a concise amino-terminal domain in nuclear respiratory factor 1 enhances DNA binding.
9108165 1997 Role of NRF-1 in bidirectional transcription of the human GPAT-AIRC purine biosynthesis locus.
8541844 1995 The pre-mRNA of nuclear respiratory factor 1, a regulator of mitochondrial biogenesis, is alternatively spliced in human tissues and cell lines.
8253388 1993 NRF-1, an activator involved in nuclear-mitochondrial interactions, utilizes a new DNA-binding domain conserved in a family of developmental regulators.
8108407 1994 Activation of the human mitochondrial transcription factor A gene by nuclear respiratory factors: a potential regulatory link between nuclear and mitochondrial gene expression in organelle biogenesis.
8034649 1994 A key transcription factor for eukaryotic initiation factor-2 alpha is strongly homologous to developmental transcription factors and may link metabolic genes to cellular growth and development.
7629110 1995 Structure, expression, and chromosomal assignment of the human gene encoding nuclear respiratory factor 1.
7558044 1995 The gene (NFE2L1) for human NRF-1, an activator involved in nuclear-mitochondrial interactions, maps to 7q32.
2584221 1989 Identification and characterization of a novel transcription factor participating in the expression of eukaryotic initiation factor 2 alpha.