Property Summary

NCBI Gene PubMed Count 26
PubMed Score 21.76
PubTator Score 15.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy -2.767 1.2e-07
adrenocortical carcinoma 1.079 4.3e-02
astrocytic glioma 1.400 1.2e-02
Astrocytoma, Pilocytic -1.700 6.5e-05
Breast cancer 2.500 3.1e-02
Chronic Lymphocytic Leukemia -1.001 6.5e-05
cystic fibrosis -1.292 1.5e-05
ependymoma -1.100 3.5e-04
glioblastoma -1.100 6.7e-03
group 3 medulloblastoma 1.200 3.9e-02
head and neck cancer -1.500 1.1e-02
intraductal papillary-mucinous adenoma (... 1.900 2.1e-03
intraductal papillary-mucinous carcinoma... 1.900 7.1e-03
invasive ductal carcinoma 1.315 2.7e-02
lung cancer 1.800 5.2e-05
malignant mesothelioma -1.300 3.3e-04
nasopharyngeal carcinoma 2.600 4.1e-04
oligodendroglioma 1.400 2.8e-02
osteosarcoma 1.724 1.3e-02
ovarian cancer -1.600 5.3e-03
pancreatic cancer 1.300 8.4e-04
Pick disease -1.100 1.5e-02
pituitary cancer 2.600 1.3e-07
primary pancreatic ductal adenocarcinoma 2.783 2.6e-03
tuberculosis 2.100 8.0e-07
urothelial carcinoma 2.700 2.3e-05
Waldenstrons macroglobulinemia 1.947 2.9e-02

Gene RIF (13)

AA Sequence

MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF        1 - 68
//

Text Mined References (27)

PMID Year Title