Property Summary

NCBI Gene PubMed Count 23
PubMed Score 20.20
PubTator Score 15.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.947 2.9e-02
chronic lymphocytic leukemia -1.001 6.5e-05
urothelial carcinoma 2.700 2.3e-05
malignant mesothelioma -1.300 3.3e-04
astrocytic glioma 1.400 1.2e-02
oligodendroglioma 1.400 2.8e-02
osteosarcoma 3.113 1.5e-04
posterior fossa group B ependymoma -1.200 1.7e-03
group 3 medulloblastoma 2.200 1.7e-02
cystic fibrosis -1.994 1.1e-04
glioblastoma -1.100 6.7e-03
acute quadriplegic myopathy -2.767 1.2e-07
adrenocortical carcinoma 1.747 4.0e-04
tuberculosis 2.100 8.0e-07
primary pancreatic ductal adenocarcinoma 2.783 2.6e-03
intraductal papillary-mucinous adenoma (... 1.900 2.1e-03
intraductal papillary-mucinous carcinoma... 1.900 7.1e-03
lung cancer 1.800 5.2e-05
pancreatic cancer 2.500 9.4e-04
Breast cancer 2.500 3.1e-02
pilocytic astrocytoma -1.600 7.7e-05
invasive ductal carcinoma 1.315 2.7e-02
nasopharyngeal carcinoma 2.600 4.1e-04
Pick disease 1.300 2.6e-03
ovarian cancer 2.100 2.8e-04
pituitary cancer 2.600 1.3e-07
head and neck cancer -1.500 1.1e-02

Synonym

Accession Q16612 B2RDN8 B7Z5D2 D3DSZ8
Symbols P311
PTZ17
SEZ17
D4S114
C5orf13
PRO1873

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

PMID Text
26616407 P311 plays a key role in renal fibrosis via TGFbeta1/Smad signaling, which could be a novel target for the management of renal fibrosis.
25336651 Novel RNA-binding protein P311 binds eIF3b to promote translation of TGF-beta1, TGF-beta2, TGF-beta3.
22967977 P311 may promote the migration of ESCs both in micewith superficial partial-thickness burns and in an injured cell model in vitro, and it may play an important role in wound healing.
22490543 Protein HYI may closely bind with protein P311 by an alpha helix in hypertrophic scar fibroblasts.
21029697 P311 and ITGB4BP expression was elevated in non-small cell lung cancer, possibly indicative of a new signaling pathway.
20404911 P311 may be involved in the pathogenesis of hypertrophic scar via induction of a myofibrobla
19460752 Knockdown of neuronal regeneration related protein homolog (rat, NREP; P311; C5orf13) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16484684 P311 expression is tightly regulated during the critical periods of alveolar formation, and that under pathologic conditions, its relative absence may contribute to failure of alveolar regeneration and lead to the development of human emphysema.
16229809 These results suggest a role for levels of P311 in regulating glioma motility and invasion through the reorganization of actin cytoskeleton at the cell periphery.
12417574 role for P311 in inducing TGF-beta1-independent myofibroblast transformation

AA Sequence

MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF        1 - 68
//

Text Mined References (24)

PMID Year Title
26616407 2015 P311 promotes renal fibrosis via TGF?1/Smad signaling.
25336651 2014 Novel RNA-binding protein P311 binds eukaryotic translation initiation factor 3 subunit b (eIF3b) to promote translation of transforming growth factor ?1-3 (TGF-?1-3).
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22967977 2012 [Effects of P 311 on the migration of epidermal stem cells in mice with superficial partial-thickness burn and injured cell model in vitro].
22490543 2012 [Analysis of the binding domain of hydroxypyruvate isomerase homologues in hypertrophic scar fibroblasts].
22365962 2012 Identification of ITGB4BP as a new interaction protein of P311.
21029697 2010 [Expression and significance of P311 and ITGB4BP in non-small cell lung cancer].
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20404911 2010 Investigating the role of P311 in the hypertrophic scar.
18664493 2008 P311 functions in an alternative pathway of lipid accumulation that is induced by retinoic acid.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16484684 2006 Identification of P311 as a potential gene regulating alveolar generation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16229809 2005 Regulation of glioma cell migration by serine-phosphorylated P311.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485502 2004 P311 accelerates nerve regeneration of the axotomized facial nerve.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417574 2002 P311 induces a TGF-beta1-independent, nonfibrogenic myofibroblast phenotype.
11358844 2001 Identification and validation of P311 as a glioblastoma invasion gene using laser capture microdissection.
10981724 2000 Metallothionein mediates gene expression of 3.1 mRNA (PTZ17) related to epileptic seizure.
10660586 2000 Regulation of P311 expression by Met-hepatocyte growth factor/scatter factor and the ubiquitin/proteasome system.
8261136 1993 An abundant mRNA of the embryonic brain persists at a high level in cerebellum, hippocampus and olfactory bulb during adulthood.