Property Summary

NCBI Gene PubMed Count 29
PubMed Score 49.91
PubTator Score 34.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 1.1e-06
Disease Target Count Z-score Confidence
substance-related disorder 104 0.0 2.0
Disease Target Count Z-score Confidence
Differentiating neuroblastoma 2 3.623 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 1.1e-06

Gene RIF (19)

PMID Text
24168165 MRNA expression of NRD1 was upregulated in 56% of ESCC tissue samples.
23604405 possible roles of nardilysin in Alzheimer disease, Down syndrome, schizophrenia, mood disorders, alcohol abuse, heroin addiction and cancer; show that nardilysin is a Janus-faced enzyme with regard to brain pathology-- probably neuropathogenic in some diseases, but neuroprotective in others [review]
23219461 This study demonistrated that alcohol-dependent reduction of nardilysin in cell culture and nervous tissue points to an implication of the enzyme in the pathophysiology of alcoholism.
22653443 NRD1 interacts with p53 mutant R273H
22351606 These results demonstrate that gastric cancer cell growth is maintained by autonomous TNF-alpha-NF-kappaB and IL-6-STAT3 signalling, and that NRDc and ADAM proteases turn on these signalling cascades by stimulating ectodomain shedding of TNF-alpha.
22294699 Identification and characterization of nardilysin as a novel dimethyl H3K4-binding protein involved in transcriptional regulation.
22174317 HIV-1 Rev interacting protein, nardilysin (N-arginine dibasic convertase) (NRD1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NRD1 is decreased by RRE
21972134 Tubulin potentiates the interaction of the metalloendopeptidase nardilysin with the neuronal scaffold protein p42IP4/centaurin-alpha1 (ADAP1).
21801775 SH-SY5Y cells, stably transfected with green fluorescent protein-tagged-p42(IP4) show enhanced NRD protein expression already at an earlier time point after retinoic acid stimulation.
21703634 Several flanking SNPs of the top hits in the meta-analysis demonstrated borderline associations with alcohol dependence in the family sample for KIAA0040, NRD1 and THSD7B, respectively.
21151101 mediates antigen processing that generates cytotoxic T cell epitopes
20877624 Observational study of gene-disease association. (HuGE Navigator)
19118164 Nardilysin convertase regulates the function of the maxi-K channel isoform mK44 in human myometrium.
18355445 These results indicate the involvement of NRDc in ectodomain shedding of TNF-alpha.
17442499 We found high staining intensity in the hypothalamus, neocortex and brain stem nuclei. The cellular localization is almost exclusively confined to neurons. In pre- and perinatal human brain cortex, most neurons express the enzyme.
16923819 Nardilysin has an essential role in HB-EGF ectodomain shedding, which is regulated by the modulation of sheddase activity
12095415 nardilysin (NRDc) is potently inhibited by heparin-binding epidermal growth factor-like growth factor (HB-EGF)
11478915 The acidic stretch of nardilysin, expressed as a fusion protein with glutathione S-transferase and compared to the native enzyme with respect to spermine binding, functions as an autonomous domain.
11432822 N-arginine dibasic convertase is a specific receptor for heparin-binding EGF-like growth factor (HB-EGF) that modulates HB-EGF-induced cell migration.

AA Sequence

MLRRVTVAAVCATRRKLCEAGRELAALWGIETRGRCEDSAAARPFPILAMPGRNKAKSTCSCPDLQPNGQ      1 - 70
DLGENSRVARLGADESEEEGRRGSLSNAGDPEIVKSPSDPKQYRYIKLQNGLQALLISDLSNMEGKTGNT     71 - 140
TDDEEEEEVEEEEDDDEDSGAEIEDDDEEGFDDEDEFDDEHDDDLDTEDNELEELEERAEARKKTTEKQS    141 - 210
AAALCVGVGSFADPDDLPGLAHFLEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRK    211 - 280
YFKEALDRWAQFFIHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETL    281 - 350
KHEPRKNNIDTHARLREFWMRYYSSHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPRPNFGHLTDPFD    351 - 420
TPAFNKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGSILSFLRKKCWALALFGGNG    421 - 490
ETGFEQNSTYSVFSISITLTDEGYEHFYEVAYTVFQYLKMLQKLGPEKRIFEEIRKIEDNEFHYQEQTDP    491 - 560
VEYVENMCENMQLYPLQDILTGDQLLFEYKPEVIGEALNQLVPQKANLVLLSGANEGKCDLKEKWFGTQY    561 - 630
SIEDIENSWAELWNSNFELNPDLHLPAENKYIATDFTLKAFDCPETEYPVKIVNTPQGCLWYKKDNKFKI    631 - 700
PKAYIRFHLISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHKLP    701 - 770
LLFQLIIDYLAEFNSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLSL    771 - 840
ESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQFQVVELPSGHHLCKVKAL    841 - 910
NKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGT    911 - 980
QATKYNSEVVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFD    981 - 1050
RLAHEIEALKSFSKSDLVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTS   1051 - 1120
PLLADCIIPITDIRAFTTTLNLLPYHKIVK                                           1121 - 1150
//

Text Mined References (36)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24168165 2014 NRD1, which encodes nardilysin protein, promotes esophageal cancer cell invasion through induction of MMP2 and MMP3 expression.
23604405 2013 Nardilysin in human brain diseases: both friend and foe.
23219461 2013 Decreased expression of nardilysin in SH-SY5Y cells under ethanol stress and reduced density of nardilysin-expressing neurons in brains of alcoholics.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
22351606 2012 Nardilysin and ADAM proteases promote gastric cancer cell growth by activating intrinsic cytokine signalling via enhanced ectodomain shedding of TNF-?.
22294699 2012 Identification and characterization of nardilysin as a novel dimethyl H3K4-binding protein involved in transcriptional regulation.
21972134 2011 Tubulin potentiates the interaction of the metalloendopeptidase nardilysin with the neuronal scaffold protein p42IP4/centaurin-?1 (ADAP1).
21801775 2011 Retinoic acid-induced upregulation of the metalloendopeptidase nardilysin is accelerated by co-expression of the brain-specific protein p42(IP4) (centaurin ? 1; ADAP1) in neuroblastoma cells.
21703634 2011 A meta-analysis of two genome-wide association studies identifies 3 new loci for alcohol dependence.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21151101 2011 Antigen processing by nardilysin and thimet oligopeptidase generates cytotoxic T cell epitopes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19118164 2009 Nardilysin convertase regulates the function of the maxi-K channel isoform mK44 in human myometrium.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18355445 2008 Ectodomain shedding of TNF-alpha is enhanced by nardilysin via activation of ADAM proteases.
17442499 2007 Histochemical evidence for wide expression of the metalloendopeptidase nardilysin in human brain neurons.
16923819 2006 Nardilysin enhances ectodomain shedding of heparin-binding epidermal growth factor-like growth factor through activation of tumor necrosis factor-alpha-converting enzyme.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15544571 2004 Nardilysin, a basic residues specific metallopeptidase that mediates cell migration and proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12590613 2003 Nardilysin cleaves peptides at monobasic sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12463163 2002 Precursor convertases in the secretory pathway, cytosol and extracellular milieu.
12095415 2002 The metalloendopeptidase nardilysin (NRDc) is potently inhibited by heparin-binding epidermal growth factor-like growth factor (HB-EGF).
11478915 2001 Expression of the acidic stretch of nardilysin as a functional binding domain.
11432822 2001 N-arginine dibasic convertase is a specific receptor for heparin-binding EGF-like growth factor that mediates cell migration.
11042131 2000 Gene expression of the dibasic-pair cleaving enzyme NRD convertase (N-arginine dibasic convertase) is differentially regulated in the GH3 pituitary and Mat-Lu prostate cell lines.
9581555 1997 Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family.
9479496 1998 Human NRD convertase: a highly conserved metalloendopeptidase expressed at specific sites during development and in adult tissues.