Property Summary

NCBI Gene PubMed Count 41
PubMed Score 196.34
PubTator Score 90.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (19)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of neuronal cell adhesion molecule (NRCAM) in primary human brain microvascular endothelial cells
23338556 A high level of Nr-CAM expression is associated with favorable tumor phenotype and reduced risk of prostate cancer recurrence.
22182708 mechanisms of NrCAM participation in development and how these might be perturbed in disorders are reviewed. [review]
21876539 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM
21718388 Nr-CAM protein expression is upregulated in colorectal cancer tissues; Nr-CAM overexpression is an independent marker of poor prognosis among advanced CRC patients, and a possible predictive marker for non-beneficence to 5-fluorouracil-based chemotherapy
20602751 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20039944 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19154219 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18664314 our results indicated that the NRCAM gene is one of the strong candidate genes for autism
18664314 Observational study of gene-disease association. (HuGE Navigator)
18602664 Distinct cytokeratin 7, cytokeratin 19, & neuronal cell adhesion molecule staining patterns are seen in hepatic adenoma & focal nodular hyperplasia possibly suggest activation of different subsets of hepatic progenitor/stem cell.
17667921 NrCAM is overexpressed in human papillary thyroid carcinoma at the mRNA and protein levels, whatever the tumour stage.
17106428 Observational study of gene-disease association. (HuGE Navigator)
12183361 induction of Nr-CAM transcription plays a role in melanoma and colon cancer tumorigenesis
11866539 Identification of endothelial cell genes expressed in an in vitro model of angiogenesis: induction of ESM-1, (beta)ig-h3, and NrCAM

AA Sequence

MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEA      1 - 70
KGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVR     71 - 140
PSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPE    141 - 210
DTREDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNK    211 - 280
EELRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIH    281 - 350
HTISVRVKAAPYWITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFS    351 - 420
NVQERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFK    421 - 490
GAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTWIVKQPEYAVVQRG    491 - 560
SMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAV    561 - 630
LSVVAPTPTPAPVYDVPNPPFDLELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEV    631 - 700
SGTQTTAQLKLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPL    701 - 770
NGFESNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHS    771 - 840
GEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGSK    841 - 910
THGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNG    911 - 980
ILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSAGSGSQITEEAVTTVDE    981 - 1050
AGILPPDVGAGKVQAVNPRISNLTAAAAETYANISWEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSF   1051 - 1120
FGLKGLMPGTAYKVRVGAVGDSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFI   1121 - 1190
RRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGE   1191 - 1260
GVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV                             1261 - 1304
//

Text Mined References (47)

PMID Year Title
23897819 2013 Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling.
23593202 2013 Bivariate genome-wide association analyses identified genes with pleiotropic effects for femoral neck bone geometry and age at menarche.
23338556 2013 High Nr-CAM expression is associated with favorable phenotype and late PSA recurrence in prostate cancer treated by prostatectomy.
22182708 2012 The role of NrCAM in neural development and disorders--beyond a simple glue in the brain.
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21718388 2011 Overexpression of neurone glial-related cell adhesion molecule is an independent predictor of poor prognosis in advanced colorectal cancer.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20039944 2010 A genome-wide association study identifies multiple loci associated with mathematics ability and disability.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19154219 2009 Association between neuronal cell adhesion molecule (NRCAM) single nucleotide polymorphisms and schizophrenia in a Korean population.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18664314 2009 Association of the neuronal cell adhesion molecule (NRCAM) gene variants with autism.
18602664 2008 Different cytokeratin and neuronal cell adhesion molecule staining patterns in focal nodular hyperplasia and hepatic adenoma and their significance.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17667921 2007 NrCAM, a neuronal system cell-adhesion molecule, is induced in papillary thyroid carcinomas.
17106428 2006 Association analysis of the NrCAM gene in autism and in subsets of families with severe obsessive-compulsive or self-stimulatory behaviors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16123759 2006 NrCAM in addiction vulnerability: positional cloning, drug-regulation, haplotype-specific expression, and altered drug reward in knockout mice.
15523497 2005 Mutation screening and association analysis of six candidate genes for autism on chromosome 7q.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128462 2004 Examination of NRCAM, LRRN3, KIAA0716, and LAMB1 as autism candidate genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14602817 2003 The role of the ankyrin-binding protein NrCAM in node of Ranvier formation.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12183361 2002 Nr-CAM is a target gene of the beta-catenin/LEF-1 pathway in melanoma and colon cancer and its expression enhances motility and confers tumorigenesis.
12139915 2002 Analysis of interactions of the adhesion molecule TAG-1 and its domains with other immunoglobulin superfamily members.
12045112 2002 RNA editing by adenosine deaminases that act on RNA.
11866539 2002 Identification of endothelial cell genes expressed in an in vitro model of angiogenesis: induction of ESM-1, (beta)ig-h3, and NrCAM.
11724816 2001 Ankyrin-G coordinates assembly of the spectrin-based membrane skeleton, voltage-gated sodium channels, and L1 CAMs at Purkinje neuron initial segments.
11483367 2001 The complete sequence of the human locus for NgCAM-related cell adhesion molecule reveals a novel alternative exon in chick and man and conserved genomic organization for the L1 subfamily.
11449000 2001 Targeted ablation of NrCAM or ankyrin-B results in disorganized lens fibers leading to cataract formation.
9604207 1998 Alternative splicing of human NrCAM in neural and nonneural tissues.
9321706 1997 Nr-CAM: a cell adhesion molecule with ligand and receptor functions.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9049255 1997 Induction of neurite outgrowth through contactin and Nr-CAM by extracellular regions of glial receptor tyrosine phosphatase beta.
8922386 1996 Neurofascin induces neurites by heterophilic interactions with axonal NrCAM while NrCAM requires F11 on the axonal surface to extend neurites.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812479 1996 Characterization of a highly conserved human homolog to the chicken neural cell surface protein Bravo/Nr-CAM that maps to chromosome band 7q31.