Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.04
PubTator Score 30.10

Knowledge Summary

Patent (2,028)

TINX Plot

  Disease (2)

Disease Target Count P-value
acute myeloid leukemia 785 2.3e-02
Disease Target Count Z-score Confidence
Bell's palsy 2 4.034 2.0
Takayasu's arteritis 54 3.254 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 2.3e-02

Gene RIF (10)

PMID Text
24910013 The present study deals with the molecular modeling of the viral protein (NS3 of DENV1-4), the host protein (NRBP) and their interactions through protein-protein docking study.
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with NRBP1
24372240 Targeting this we performed homology modeling and protein-protein docking study of NS3 with NRBP (Nuclear Receptor Binding Protein) of human as it has been proved that NS3 of DENV interacts with NRBP which causes cellular trafficking in human cell.
22510880 It was shown that NRBP1 is a tumour suppressor that plays a critical role in intestinal cell homoeostasis. NRBP1 levels are reduced in a wide variety of human tumours. Reduced NRBP1 levels in lung cancer correlates with a poor prognosis.
22473923 High NRBP1 expression in prostate cancer is linked with poor clinical outcomes and increased cancer cell growth.
18976975 Knockdown of nuclear receptor binding protein 1 (NRBP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17052710 NRBP may be an important negative regulator of Jab1-mediated functions such as gene transcription and tumor progression.
15084397 NS3 protein of dengue virus type 2 interacted specifically with nuclear receptor binding protein, a host cellular protein that influences trafficking between the endoplasmic reticulum and Golgi, and that interacts with Rac3
12176995 mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1
11956649 Interaction of the small GTPase Rac3 with NRBP: results suggest that NRBP functions in subcellular trafficking and may be directed to specific subcellular locations through interaction with small GTPases of the Rho family

AA Sequence

MSEGESQTVLSSGSDPKVESSSSAPGLTSVSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREE      1 - 70
VNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIK     71 - 140
ENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFI    141 - 210
QHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGES    211 - 280
SYVPQEAISSAIQLLEDPLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPE    281 - 350
NALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEV    351 - 420
TSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELA    421 - 490
AELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS                             491 - 535
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24910013 2014 Insight into structural organization and protein-protein interaction of non structural 3 (NS3) proteins from dengue serotypes.
24372240 2013 Design, virtual screening and docking study of novel NS3 inhibitors by targeting protein-protein interacting sites of dengue virus - a novel approach.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22510880 2012 Nuclear receptor binding protein 1 regulates intestinal progenitor cell homeostasis and tumour formation.
22473923 2012 High NRBP1 expression in prostate cancer is linked with poor clinical outcomes and increased cancer cell growth.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17052710 2006 Adapter protein NRBP associates with Jab1 and negatively regulates AP-1 activity.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15084397 2004 The non-structural 3 (NS3) protein of dengue virus type 2 interacts with human nuclear receptor binding protein and is associated with alterations in membrane structure.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176995 2002 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1.
11956649 2002 Interaction of the small GTPase Rac3 with NRBP, a protein with a kinase-homology domain.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10843813 2000 Cloning of the cDNA and localization of the gene encoding human NRBP, a ubiquitously expressed, multidomain putative adapter protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1048605 [A nurse with the drug addicts].