Property Summary

NCBI Gene PubMed Count 363
PubMed Score 880.39
PubTator Score 1131.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2346 6.036 3.0

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.411 5.1e-04
glioblastoma 1.500 1.1e-03
atypical teratoid/rhabdoid tumor 1.600 1.5e-06
juvenile dermatomyositis 1.284 4.0e-12
primary pancreatic ductal adenocarcinoma 1.058 7.9e-03
Breast cancer 4.500 2.2e-02
pediatric high grade glioma 1.500 7.0e-05
group 3 medulloblastoma 1.200 1.9e-04
ovarian cancer 2.100 3.3e-05

Gene RIF (321)

PMID Text
26807515 MC1R status is associated with BRAF(V600E), BRAF(V600K), and NRAS mutations in cutaneous melanomas
26701913 ABHD17 catalytic activity is required for N-Ras depalmitoylation and re-localization to internal cellular membranes.
26597176 The patient's resected brain tumor is BRAF V600E mutated, NRAS wild type (WT), and TERT C250T mutated. The patient is a carrier of germline variants in immunomodulatory loci associated with prolonged survival.
26581482 Data show that 11/105 patients failed all molecular analysis: no mutations in oncogenes EGFR, KRAS and NRAS were detected, and no ALK gene rearrangements or MET gene amplifications were identified.
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26562020 Data indicate that mutations in PTEN phosphatase A167T and NRAS protein Q61L, and proto-oncogene protein BRAF V600E were detected in melanoma cell line.
26560143 analysis of HRAS, KRAS and NRAS expression in colorectal tumor cells
26547258 study concluded that 26% of patients had detectable FLT3-ITD or RAS mutation at transformation from myelodysplastic syndrome to acute myeloid leukemia, and these mutations were associated with very poor outcome
26515069 The neutron crystal structure presented here puts in question our understanding of the pre-catalytic state associated with the hydrolysis reaction central to the function of RAS and other GTPases.
26471487 NRAS mutation is associated with response to therapy in Colorectal Carcinoma.
26467218 Case report and review analyses showed that NRAS c.179G > A mutation is associated with familial Noonan Syndrome and predispose to hyperpigmented lesions.
26440707 Levels of BRAF(mutant) and NRAS(mutant) ctDNA were determined using droplet digital PCR (ddPCR) assays. Among patients with samples available prior to treatment initiation ctDNA and LDH levels were elevated in 12/15 (80%) and 6/20 (30%) (p = 0.006) patients respectively
26426340 NRAS Mutation is associated with response to therapy in Advanced Melanoma.
26393682 let-7 is a tumor suppressor that negatively regulates RAS, also in Ewing Sarcoma, and HIF-1alpha may contribute to the aggressive metastatic behavior of Ewing Sarcoma
26325669 Data suggest that Src kinases inhibitors may act with different mechanisms in non-small cell lung cancer (NSCLC) depending on EGF receptor (EGFR)/Ras protein (Ras) mutational profile.
26318427 Studies indicate that KRAS and NRAS mutations are currently recognized as the best predictive factors for primary resistance to anti-EGFR monoclonal antibodies.
26305188 NRAS mutation was associated with a worse disease evolution in a selected cohort of patients affected by pulmonary metastases of malignant melanoma.
26297254 NRASQ61R and BRAFV600E immunohistochemistry coupled with next-generation sequencing allow detection of mutations in melanoma challenging samples.
26282084 mutations found in face and palm or sole melanoma in Japanese patients
26272610 comparison of the GTPase reaction of the slower hydrolyzing GTPase Ran with Ras
26253102 RAS-positive thyroid nodules, especially in older individuals, frequently demonstrate a benign phenotype.Cytologically benign nodules, even if RAS-positive, may be candidates for a non-operative observational strategy
26225944 BRAF mutations are infrequent, whereas C-KIT and NRAS mutations are seen with higher frequency in vulvar melanomas than melanomas of other sites.
26222068 The prevalence of oncogenic RAS mutations was higher among Arab Asian children than in other countries. RAS mutations in AML were found to coexist with other genetic aberrations, particularly MLL rearrangement
26220150 Evaluation of mutations in NRAS exons 2, 3, and 4-can define the patient with metastatic Colorectal cancer that is unlikely to benefit from anti- Epidermal Growth Factor Receptor therapy.
26181424 NRASQ61K mutation is associated with recurrence in Neuroblastoma.
26146664 Report 3-fold increased risk of death for higher-risk melanomas harboring NRAS or BRAF mutations.
26096079 Mutations in NRAS have been identified in approximately 15-20% of melanomas.
26090869 BRAF, NRAS and KRAS gene mutations in plasma cell dyscrasias may have a role MEK-ERK pathway activation
26049686 Meta-analysis: robust estimates of overall RAS mutation prevalence and individual variation patterns in metastatic colorectal cancer patients.
25999467 ABL phosphorylates tyrosine 137 of H-, K-, and NRAS.
25999051 RAS mutation targeting the Korean population showed 45.7% frequency in follicular-derived thyroid neoplasms.
25997687 NRAS activating mutation is relatively low in Korean colorectal cancer patients.
25926041 Case Report: coexisting KRAS/NRAS mutations in caecal adenocarcinoma and contiguous tubulovillous adenoma.
25920435 NRAS gene mutation was significantly associated with lung metastasis.
25914220 In the title.
25901794 AML with inv(16) and NRAS mutation have a differentiation gene signature
25896945 somatic mosaicism for a mutation accounts for disparate phenotypes in RAS-associated leukoproliferative disease
25886136 Among 264 patients, mutations in KRAS exon 2, KRAS exons 3 or 4, NRAS, BRAF and PIK3CA were detected in 34.1%, 3.8%, 4.2%, 5.4% and 6.4%, respectively. Thus, a total of 12.1% of patients without KRAS exon 2 mutations had other RAS mutations
25858894 studied 269 Chinese (mostly Han) with de novo AML. FLT3-ITD was detected in 51 subjects (23%; 95% CI, 17-28%), R882 mutation of DNMT3A in 17 (6%; 95% CI, 3-9%) and NRAS mutation in 17 (7%; 95% CI, 3-9%).
25851630 NRAS mutations are usually present in the majority of metastatic colorectal cancer cells.
25815427 Activated NRAS and aberrant Wnt signaling conspire to drive congenital melanocytic nevus syndrome.
25796376 Combination strategies of immune and targeted therapies may also play a role in the future although clinical trials testing these approaches are in early stages.
25749811 NRAS mutation is not associated response to chemotherapy in melanoma.
25736262 NRAS mutations in advanced melanoma correlate with increased benefit from immune-based therapies compared with other genetic subtypes.
25722211 The CM cell lines, as well as the tumor xenografts and their metastases, were positive for the melanoma markers HMB-45, S100B, and MART-1. Two cell lines and their corresponding xenografts carried a BRAF mutation, the third showed an NRAS mutation.
25695684 RAS mutations cause vascular tumors including pyogenic granuloma
25666295 NRAS mutations are associated with Metastatic Colorectal Cancer.
25659223 We aimed to assess the diagnostic accuracy of an immunohistochemistry using a noel anti-NRAS monoclonal antibody on the samples from patients with metastatic melanoma.
25645078 The combination of PRi + MEKi can be an effective regimen for blocking proliferation of NRAS mutant melanomas.
25627962 suggests that PIK3CA mutations account for a small fraction of PI3K pathway activation and have a limited impact in interfering with the BRAF/NRAS-driven growth in melanoma
25491172 Study sequenced a large clinical series of patients with metastatic colorectal cancer (mCRC) for RAS and PIK3CA mutations. RAS alterations occurred in 48% of mCRC cases, with mutations within KRAS exon 2 in 43%, KRAS exons 3 and 4 in 3%, and NRAS in 2% of cases. PIK3CA mutations occurred in about 10% of mCRC and were significantly associated with concurrent RAS mutation.
25385688 Results show that mutated NRAS is associated with melanomas that are more aggressive.
25373533 This expert group recommends testing for KRAS and NRAS status in all patients with metastatic CRC being considered for anti-epidermal growth factor receptor (anti-EGFR) therapy
25363723 BRAF and NRAS alterations are preserved during in vitro culture in melanoma in a series of patients in which the c-KIT mutation was not detected
25361812 NRAS expression is required for the proliferative advantage of human AML cell lines in vitro and for the maintenance of mouse Nras-mutant AML in vivo
25337237 Report NRAS mutation status in colorectal neoplasms and neuroendocrine differentiation in primary/metastatic colorectal neoplasms.
25316818 Our findings suggest that NRAS is an oncogenic driver in serous ovarian tumors.
25316678 Analysis of the gene-expression patterns of leukemic subpopulations revealed that the NRAS(G12V)-mediated leukemia self-renewal signature is preferentially expressed in the leukemia stem cell-enriched subpopulation.
25263998 report the cases of two children, presenting a melanocytic lesion located on the ear with an exon 3 NRAS mutation
25252692 This work explains the curious predominance in human melanoma of mutations of codon 61 of NRAS over other oncogenic NRAS mutations. we show that physiologic expression of NRASQ61R, but not NRASG12D, drives melanoma formation.
25227306 NRAS mutation is associated with response to chemotherapy in colorectal liver metastases.
25204082 NRAS mutations are associated with acute leukemia.
25164765 Targeted sequencing on primary, metastatic, and normal tissue from colorectal cancer patients found a high degree of concordance for KRAS, NRAS, and BRAF mutations that were identical in both the primary and metastatic tumors.
25158650 acylation state of Ras proteins (H-Ras and N-Ras) controls not only their distribution between the Golgi apparatus and the plasma membrane, but also their distribution within the Golgi stacks.
25157176 Ras-tyrosine 32 serves as an Src-dependent keystone regulatory residue that modulates Ras GTPase activity and ensures unidirectionality to the Ras GTPase cycle.
25150293 These results provide a rationale for targeting mutant RAS or PI3K/AKT/mTOR signaling in the subset of Eedheim Chester disease patients with NRAS or PIK3CA mutations.
25109485 RAS mutations in indeterminate thyroid nodules have a role in follicular variant of papillary thyroid carcinoma
25105841 NRAS and KRAS mutations have a role in Down syndrome acute lymphoblastic leukemia that lacks JAK2 mutations
25063807 NRAS expression and increased MAPK activation drive vemurafenib resistance in V600E BRAF+ve melanoma.
25048604 No association was found between NRASQ61R mutation and melanoma risk factors or melanoma-specific survival.
25009008 Clinicopathologic characteristics, survival outcomes, functional impact, and gene expression profiling were similar between patients with KRAS 12/13 and those with NRAS or KRAS 61/146-mutated colorectal cancers
24962318 TBK1 promotes the malignant properties of NRAS-mutant melanoma and its targeting.
24950457 amuvatinib has proapoptotic activity against melanoma cell lines, with selectivity observed for those harboring oncogenic NRAS but not BRAF
24941944 our data suggest that the genetic background in melanoma cells influences the response to inhibitors blocking de novo DNA synthesis, and that defining the RAS mutation status could be used to stratify patients for the use of antifolate drugs.
24918823 BRAF and NRAS mutation status does not influence survival in metastatic melanoma.
24906137 BET inhibition with I-BET151 appears independent of the BRAF and NRAS mutational status of melanoma
24866436 NRAS mutation is associated with melanoma nodal metastases and an unknown primary site.
24859998 The high-resolution melting method developed was shown to be a reliable method for NRAS mutation detection
24820091 RAS mutation, especially a NRAS codon 61 mutation, was significantly associated with the distant metastasis in follicular thyroid carcinoma
24806883 Characteristics and prognosis of colorectal cancer with NRAS mutations are different from those with KRAS or BRAF mutations.
24806288 NRAS mutations affect metastatic colorectal cancer patients' prognosis and predict lack of response to EGF receptor antagonists.
24802725 NRAS mutations were more prevalent than KIT mutations in a series of melanomas arising from the female urogenital tract.
24798740 analysis of RAS, RET/PTC, and BRAF mutations in advanced stage of papillary thyroid carcinoma
24774510 This study indicated that mutations of KRAS, PIK3CA and NRAS were rare in advanced gastric cancer.
24758538 This review will point attention on Neuroblastoma-RAS (NRAS) status in metastatic CRC (mCRC) patients (pts) selected for anti-EGFR therapy
24737308 In cytogenetically normal acute myeloid leukemia, activating N-RAS mutations in codons 12, 13, or 61 were detected in 22 of 204 patients.
24714776 NRAS mutation is associated with melanoma.
24710085 mutations in BRAF and NRAS are not mutually exclusive because they were simultaneously present in the same tumor specimens
24703650 Mutations of N-ras are present in multiple congenital neavi. A nonsense mutation afects the codon 61 N-ras.
24691006 the outcome of 68 patients with advanced colorectal cancer and RAS, BRAF and PI3KCA status according to ALK gene status, is reported.
24666267 Mutations in NRAS predict resistance to anti-EGFR therapies.
24610751 Missense mutation in NRAS is associated with concurrent juvenile myelomonocytic leukemia and T-lymphoblastic lymphoma.
24603591 NRAS mutations and KIT amplifications occur in melanomas originating from the vulva or vagina
24590757 Somatic N-RAS G38A-->Gly13Asp substitution was restricted to hematopoietic cells
24588908 prognosis of patients with melanoma expressing constitutively active N-RAS is poor
24586049 NRAS isoforms differentially affect downstream pathways, cell growth, and cell transformation.
24509877 MAF has a role in mediating crosstalk between Ras-MAPK and mTOR signaling in NF1
24335104 NRAS mutations in myeloma patients were associated with a significantly lower response rate to single-agent bortezomib.
24222113 NRAS mutations are associated with proliferative thyroid lesions.
24189344 Study suggests TRIM33 and NRAS-CSDE1 as candidate genes for autism, and may provide a novel insight into the etiology of autism
24166518 Report role of NRAS oncogenetic risk classification in the prognosis of adult T-cell acute lymphoblastic leukemia.
24129063 analysis of the NRAS mutation, which is the sole recurrent somatic mutation in large congenital melanocytic nevi
24067137 NRAS mutations were associated with poorer overall survival of patients with pediatric B cell precursor acute lymphoblastic leukemia.
24024839 RAS mutations predict a lack of response to anti-EGFR therapy in patients with metastatic colorectal cancer.
24018645 KRAS/NRAS mutation predicts early lung recurrence and worse survival after curative resection of colorectal liver metastases.
24006859 mutations in KRAS codon 61, KRAS codon 146, BRAF, NRAS, or PIK3CA detected in Asian patients were not predictive of clinical benefits from cetuximab treatment.
24006476 Finding of somatic activating HRAS and NRAS mutation in bone, the endogenous source of FGF23, provides the first evidence that elevated serum FGF23 levels, hypophosphatemia and osteomalacia are associated with pathologic Ras activation.
23993026 mutation in acral lentiginous melanoma of Swedish patients
23987572 Prevalence and distribution of pathogenetic mutations in BRAF and NRAS genes were evaluated in multiple melanoma lesions from patients with different geographical origin within the same Italian population.
23922205 Comparison of 136 melanoma patients with NRAS exon 1 (18%) and exon 2 (82%) mutations found an association with primary tumor histology (P = .0096) only.
23861977 the presence of a BRAF- or NRAS mutation in a nevus was not associated with the risk of malignant transformation.
23860532 Findings show that KIT and BRAF mutations are only rarely present in SNMMs, whereas NRAS mutations seem to be relatively more frequent.
23855428 The study found a high concordance of NRAS mutation status between paired metastases diagnosed at different time points.
23833303 Melanomas arising in SSD skin have higher mutation loads and contain a spectrum of molecular subtypes compared with BRAF- and NRAS-mutant tumors indicating multigene screening approaches
23821376 This study investigated the impact of KRAS, NRAS, BRAF, PI3KCA and TP53 status on outcome of elderly metastatic colorectal cancer patients
23795354 Co-amplification of these candidate genes or the CCND1 amplification along with either BRAF or NRAS mutations might be more important for prognosis than the presence of these alterations alone.
23782496 BRAF, NRAS, and c-Kit molecular analyses among patients affected by nail apparatus melanoma were investigated.
23774633 NRAS mutation is associated with myelodysplastic syndromes and acute myeloid leukemia.
23771122 We found that inherited variants od CDKN2A have no effect of ther prevalence of BRAF/NRAS mutations in melanoma.
23758196 Data suggest that NRAS activation occurs at the plasma membrane and suggest that depalmitoylation, and thereby removal of NRAS from the plasma membrane, contributes to down-regulation of signal transduction involving Ras proteins.
23739925 The frequency of NRAS mutations is lower in the Asian population than in Caucasian patients with primary and metastatic melanomas.
23708912 NRAS mutations are associated with myelodysplastic syndromes.
23687087 Nras(G12D/+) mutation promotes leukemogenesis.
23673558 low BRAF as well as NRAS expression levels were associated with a longer progression-free survival in the total population
23667841 We observed 3 cases with N-ras mutations in codon 12 (3.6%), 2 cases in codon 13 (2.4%), and 1 case in codon 61 (1.2%).
23664541 NRAS or KIT mutations and cyclin D1 amplification can be found in a proportion of primary melanomas of the sinonasal tract.
23633454 The presence of NRAS or BRAF mutations in a mutually exclusive pattern in roughly half (47%) of conjunctival melanomas and the pattern of CNAs argue for conjunctival melanoma being closely related to cutaneous and mucosal melanoma
23538902 these studies have identified Wee1 as a key target of XL888, suggesting novel therapeutic strategies for NRAS-mutant melanoma.
23536553 findings implicate the HMGA2-IGFBP2-NRAS signaling pathway as a critical oncogenic driver in embryonic rhabdomyosarcoma
23515407 NRAS mutations define a distinct subset of lung cancers with potential sensitivity to MEK inhibitors.
23496764 Wild-type copies of HRas, NRas and KRas play unique roles in the context of mutant KRas-driven tumours.
23477374 Data suggest that mutations in NRAS are relatively common (7/28 patients, 25%, p.Gln61Arg) in subjects with partially-encapsulated or well-circumscribed follicular variant of papillary thyroid carcinoma in Boston area.
23448684 A significant proportion of fast-growing melanomas bear mutations in NRAS.
23423222 Gene expression changes due to neurofibromin modulation but independent of NRAS and MEK1/2 regulation in malignant peripheral nerve sheath tumor cells indicated bone morphogenetic protein 2 (Bmp2) signaling as a key pathway.
23403319 study demonstrated that RAS mutations frequently occur in Mixed Lineage Leukemia (MLL)-rearranged infant acute lymphoblastic leukemia (ALL) cases and especially in t(4;11)-positive infant ALL patients and their presence represents an independent poor prognostic factor
23392294 These results suggest that single postzygotic NRAS mutations are responsible for multiple congenital melanocytic nevi and associated neurological lesions in the majority of cases.
23362874 mutations in N-RAS may play a role in acral lentiginous melanomas
23313659 mutational status of N-RAS and K-RAS genes in a cohort of 504 Chinese acute myeloid leukemia patients; mutation frequency of N-RAS and K-RAS were 9.7 percent and 2.9 percent respectively; concluded RAS mutations are associated with some biologically specific subtypes of AML but don't impact clinical outcome in Chinese patients
23303902 Primary melanoma of the CNS in children is driven by congenital expression of oncogenic NRAS in melanocytes
23262097 Cooperation between p53 and v-Ras control critical genes related to tumorigenesis.{review]
23240926 The prevalence of RAS mutations in the present series of medullary thyroid cancer (MTC) was 10.1%, and 17.6% when considering only RET-negative cases. RAS mutations were found in MTC tumor tissue but not in peripheral blood indicating their somatic origin
23233531 miR-148b controls malignancy by coordinating a novel pathway involving over 130 genes and, in particular, it directly targets players of the integrin signaling, such as ITGA5, ROCK1, PIK3CA/p110alpha, and NRAS, as well as CSF1
23201159 MiR-145 suppressed AKT and ERK1/2 pathways and HIF-1 and VEGF expression by targeting N-RAS and IRS1
23153525 Localization of the NRAS:BCL-2 complex determines anti-apoptotic features associated with progressive disease in myelodysplastic syndromes.
23096702 We found that NRAS-mutant melanomas were significantly more likely from older patients and BRAF-mutant melanomas were more frequent in melanomas from the trunk.
23076151 SHOC2 and CRAF mediate ERK1/2 reactivation in mutant NRAS-mediated resistance to RAF inhibitor.
23000456 The cAMP pathway is more frequently impaired in melanoma than could be predicted by the MC1R or NRAS genotype.
22997201 identified a single activating mutation in NRAS and complete absence of oncogenic mutations in all other genes tested in aggressive pediatric rhabdoid tumors
22983396 findings suggest a gradient model of oncogenic NRAS signaling in which the output is gated, resulting in the decoupling of discrete downstream biological phenotypes as a result of incomplete inhibition.
22974165 N-ras expression was not associated with pathogenesis and biological behavior of thymic epithelial neoplasms.
22931913 We conclude that the presence of BRAF mutation, NRAS mutation, and the absence of an immune-related expressed gene profile predict poor outcome in melanoma patients with macroscopic stage III disease.
22926523 GAB2 is a novel regulator of tumor angiogenesis in NRAS-driven melanoma
22912864 Data indicate that mutation frequency in malanoma patients was found witih BRAF(V600) in 51%, NRAS in 19%, PI3K pathway in 41% and PTEN in 22%.
22887781 NRAS germline mutations are a rare cause of Noonan syndrome or juvenile myelomonocytic leukemia.
22820081 oioiuh ohhiu iuhli u hliuh liuh iluh
22809251 As has been reported in other common types of melanoma, V600 BRAF mutation is the most common mutation of those tested in spindle cell melanoma. NRAS or KIT mutation appears to be rare, if not completely absent.
22773810 Lung cancers with acquired resistance to EGFR inhibitors occasionally harbor BRAF gene mutations but lack mutations in KRAS, NRAS, or MEK1.
22758774 In primary melanocytic tumours of the CNS, GNA11 and N-RAS mutations represent a mechanism of MAPK pathway activation alternative to the common GNAQ mutations
22753870 study reports 2 patients with somatic mosaicism for oncogenic NRAS mutations (G12D and G12S) associated with the development of juvenile myelomonocytic leukemia
22650231 Thyroid follicular carcinomas harbored RAS mutations, and the mutation was predominantly found in the NRAS codon 61 (22/33, 67%).
22614978 BRAF/NRAS mutations were identified in 58% of primary melanomas
22589270 study examined the mutational spectra of Ras isoforms curated from large-scale tumor profiling and found that each isoform exhibits surprisingly distinctive codon mutation and amino-acid substitution biases
22456166 Report marked differences in the genetic pattern of the BRAF or NRAS mutated and wild-type melanoma subgroups.
22427190 Investigation the prevalence of mutations in the NRAS gene and its correlation with demographic characteristics, tumor location and stage in 100 colorectal carcinoma patients from India.
22407852 KRAS mutations to be more frequent than NRAS mutations in pediatric patients with acute myeloid leukemia.
22199277 RET mutations may have a role in medullary thyroid carcinoma, while BRAF, AKT1, and CTNNB1 do not; the role of HRAS, KRAS, and NRAS mutations are not determined
22180178 NRAS mutation status was identified as an independent predictor of shorter survival after a diagnosis of stage IV melanoma.
22130161 correlation of mutations with clinical response to high-dose IL-2 in patients with advanced melanoma
22123847 HIV-1 Nef-induced relocalization of LCK is correlated with N-Ras activation at recycling endosome/TGN compartments
22120021 Activated human N-ras v12 can play a role in murine B- and plasma cell homeostasis & that activated N-Ras & c-Myc can cooperate to induce B-cell neoplasia.
22020736 c-Met is more likely to be activated in both NRAS-mutated and wt/wt melanomas; melanoma cells with these genotypes, particularly NRAS mutants, are more sensitive to pharmacologic c-Met inhibition
21908617 analysis of N-Myc and c-Myc synthesis, degradation, and transcriptional activity by the Ras/mitogen-activated protein kinase pathway
21809347 Wild type N-ras appears to mediate its anti-malignant effect by downregulating decorin expression.
21796448 N-RAS Q61R mutation was detected in 6% of tumours, 3% of classic papillary thyroid carcinoma and 10% of follicular variant papillary thyroid carcinoma.
21788131 Patients with mutations in BRAF or NRAS gene are frequently present with ulceration, and mutation in BRAF or NRAS gene is indicator for poor prognosis.
21757746 Cholangiocyte N-Ras protein mediates lipopolysaccharide-induced interleukin 6 secretion and proliferation
21750866 The low frequency of NRAS and BRAF mutations indicate that these genes are not common, but probable events in oral mucosal melanoma pathogenesis.
21615881 NRAS mutations were associated with thicker tumors and higher rates of mitosis when compared to BRAF(V600E) and wild type melanoma.
21595878 The study demonstrated that activated NRAS played an important part for delNS1 H5N1 virus replication in MDCK cells.
21586752 The tumor transformation potential of endogenous oncogenic Nras is both dose- and cell type-dependent.
21430505 The NRAS codon 61 mutation in giant congenit-al melanocytic nevi was significantly related to the amount of sun exposure.
21358716 NRASmut did not affect the outcome in pediatric acute myeloid leukemia
21305640 26 of colorectal tumors were mutant for NRAS.
21283084 Alterations of the NRAS gene is associated with myelodysplastic syndromes and acute myeloid leukemia.
21263000 Mutations in NRAS from individuals with Noonan syndrome activated N-Ras signaling and induced developmental defects in zebrafish embryos.
21209378 study analyzed 90 samples of cutaneous T-cell lymphomas patients and found 2 KRAS (G13D) and 2 NRAS (Q61K) mutations
21200020 N-Ras(G12D) induces features of stepwise transformation in preleukemic umbilical cord blood cultures expressing the AML1-ETO fusion gene.
21168197 Mutations in PIK3CA, KRAS and NRAS were exclusive to tumors of uterine origin and age-adjusted Cox proportional hazards modeling associated advanced age, stage and TP53 mutations with decreased survival in the uterine subset.
21166657 NRAS mutation was frequently evident in patients with nodular melanoma (OR=1.894; P<0.001) and in melanomas arising in chronic sun-damaged skin (OR=1.887; P=0.018).
21134978 Activating mutations, specifically in NRAS, are found exclusively in advanced forms of systemic mastocytosis and may precede the proto-oncogene protein c-kit D816V mutation in clonal development.
21131919 Primary esophageal melanomas of Caucasian patients did not harbor mutations of NRAS.
21107323 melanomas escape B-RAF(V600E) targeting not through secondary B-RAF(V600E) mutations but via receptor tyrosine kinase (RTK)-mediated activation of alternative survival pathway(s) or activated RAS-mediated reactivation of the MAPK pathway
21072204 Observational study of gene-disease association. (HuGE Navigator)
20975100 Observational study of gene-disease association. (HuGE Navigator)
20881644 Observational study of gene-disease association. (HuGE Navigator)
20880116 Observational study of gene-disease association. (HuGE Navigator)
20860430 Observational study of gene-disease association. (HuGE Navigator)
20824703 Observational study of gene-disease association. (HuGE Navigator)
20815269 Yiqi Yangyin Recipe can inhibit the colonic proliferation of AML cells, and decrease the expressions of FLT3 and N-ras.
20736745 NRAS mutations were detected in 5 (2.2%) of the 225 colorectal cancers and tended to occur in left-sided cancers arising in women, but did not seem to be associated with any of the molecular features that were examined.
20736745 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20726318 the frequency and spectrum of N-RAS gene mutation differ between biologically distinct subtypes of AML but do not significantly influence prognosis and clinical outcome in patients with AML.
20726318 Observational study of gene-disease association. (HuGE Navigator)
20720566 association between MC1 receptor germline variation and BRAF/NRAS mutations in melanoma
20720566 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20713885 Endogenous Ras activation occurs only at the plasma membrane of live Jurkat T lymphocytes; all signals transmitted via the T cell receptor/Ras pathway originate at the T cell surface.
20703244 p16(INK4A) promoter methylation in melanoma was significantly overrepresented in NRAS-mutated samples compared to NRAS wild-type samples (P=0.0004), indicating an association between these two events
20680410 experiments further confirmed the link between the loss of neurofibromin and increased activity of Ras/MAP kinase pathways and the activation of downstream transcriptional mechanisms in MPNSTs from NF1 patients
20678218 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619739 if KRAS is not mutated, assessing BRAF, NRAS, and PIK3CA exon 20 mutations (in that order) gives additional information about the efficacy of cetuximab plus chemotherapy in metastatic colorectal cancer.
20619739 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20526288 Observational study of gene-disease association. (HuGE Navigator)
20520634 Observational study of gene-disease association. (HuGE Navigator)
20392691 Ras induces ARC in epithelial cancers, and ARC plays a role in the oncogenic actions of Ras
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20371679 NRAS mutations contribute to evolution of chronic myelomonocytic leukemia to the proliferative variant.
20237506 NRAS mutations are associated with relapsed childhood high hyperdiploid acute lymphoblastic leukemia.
20192584 Specific point mutations of activated N-ras were detected in 9% (5 of 55) of the bladder cancer patients, all being missense.
20157749 Significant K-ras mutations were frequently detected in the major duodenal papilla and gastric and colonic mucosa of autoimmune pancreatitis patients
20150643 Observational study of gene-disease association. (HuGE Navigator)
20147298 whereas H-Ras and N-Ras were unable to localize to the plasma membrane in the presence of USP17, K-Ras4b localization was unaffected
20140953 Formalin-fixed primary melanomas from relapsed and nonrelapsed patients were sequenced for common BRAF and NRAS mutations. BRAF/NRAS mutations were detected in 77% of relapsers and 58% of nonrelapsers and did not predict ulceration or mitotic rate.
20098682 Observational study of genetic testing. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20012784 Screening for BRAF, RET, KRAS, NRAS, and HRAS mutations, as well as RET-PTC1 and RET-PTC3 rearrangements, was performed on cases of Hashimoto thyroiditis with a dominant nodule
19966803 study reports that germline NRAS mutations conferring enhanced stimulus-dependent MAPK activation account for some cases of Noonan syndrome; findings provide evidence for an obligate dependency on proper NRAS function in human development and growth
19954345 Although oncogenic NRAS expression alone was found to be insufficient to promote tumor formation, loss of functional p53 was found to collaborate with NRAS expression in the genesis of melanoma.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874312 assessment of NRAS mutations in juvenile myelomonocytic leukaemia
19865112 Observational study of gene-disease association. (HuGE Navigator)
19833857 RAS and CSF3R mutations in severe congenital neutropenia.
19819220 Backbone conformational flexibility of the lipid modified membrane anchor of the human N-Ras protein investigated by solid-state NMR and molecular dynamics simulation.
19802003 Data show that in hypoxic conditions or coexpressed with a constitutively active form of HIF-1alpha, c-Kit mutants activate the Ras/Raf/Mek/Erk pathway, stimulate proliferation and transform melanocytes.
19789336 NRAS mutations affect tumor necrosis factor-induced apoptosis in colon carcinoma cells via ERK-modulatory negative and positive feedback circuits along with non-ERK pathway effects
19765726 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19759551 analysis of coexisting NRAS and BRAF mutations in primary familial melanomas with specific CDKN2A germline alterations
19718661 analysis of the effect on the Ras/Raf signaling pathway of post-translational modifications of neurofibromin
19705759 Transformation with N-RAS proved to increase the leading edge proportion and to considerably redistribute pseudopodial activity along the cell edge.
19633643 Characterization of candidate gene copy number alterations in the 11q13 region along with BRAF and NRAS mutations in human melanoma.
19492075 Targeting NRAS alone or both BRAF and CRAF in combination or both BRAF and PIK3CA together showed delay in tumor growth.
19487299 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19383313 REVIEW summarizes the literature on NRAS and BRAF activating mutations in melanoma tumors with respect to available data on histogenetic classification as well as body site and presumed UV-exposure.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19319568 The present study indicates that esophageal neoplasms have a high frequency of NRAS mutations unlike mucosal neoplasms of other sites.
19309322 Observational study of gene-disease association. (HuGE Navigator)
19303097 Observational study of gene-disease association. (HuGE Navigator)
19190079 Mutation in NRAS is associated with adrenocortical carcinomas.
19101897 failed to find nRAS mutations in bladder tumor samples
19047918 Observational study of gene-disease association. (HuGE Navigator)
19037234 NRAS and BRAF mutations increase from the radial to the vertical growth phase in cutaneous melanoma
18980976 Observational study of gene-disease association. (HuGE Navigator)
18945298 No NRAS1 mutations were observed in both the melanocytic aggregate and the melanoma
18814281 suppression of oncogenic NRAS by siRNA can induce growth arrest and inhibit invasion of human melanoma cells by modulating the levels of these gene products
18788612 Observational study of gene-disease association. (HuGE Navigator)
18760455 Stimulation of human mast cells by activated T cells leads to N-Ras activation through Ras guanine nucleotide releasing protein 1.
18701506 Mutation in NRAS is associated with childhood acute lymphoblastic leukemia
18668139 N-RAS(Q61K) and B-RAF(V600E) contribute to melanoma's resistance to apoptosis in part by downregulating Bim expression
18667611 HIV-1 Nef-induced relocalization of LCK is correlated with N-Ras activation at recycling endosome/TGN compartments
18641128 analysis of a signaling mechanism for the regulation of the Ras/ERK pathway based on the eNOS-dependent differential activation of N-Ras and K-Ras at specific cell compartments
18632627 co-overexpression of KIT/CDK4 is a potential mechanism of oncogenic transformation in some BRAF/NRAS wild-type melanomas
18615679 Observational study of gene-disease association. (HuGE Navigator)
18567617 Silencing of N-Ras gene expression using shRNA decreases transformation efficiency and tumor growth in transformed cells induced by anti-BPDE.
18559876 AML patients carrying mutRAS benefit from higher cytarabine doses more than wtRAS patients. This seems to be the first example of an activating oncogene mutation favorably modifying response to higher drug doses in AML.
18450602 Observational study of gene-disease association. (HuGE Navigator)
18375819 NRAS mutation is associated with disease stabilization in melanoma
18323787 Mitogen-activated protein kinase (MAPK) activity is subject to regulation even in BRAF/NRAS mutant melanoma cells and that high MAPK pathway signaling may be important only in distinct subsets of tumor cells.
18316589 the Ras-Net (Elk-3) pathway involves microtubules and is inhibited by pyrazoles
18316586 restricting CDC25A can limit tumorigenesis induced by the HER2/neu-RAS oncogenic pathway without compromising normal cell division or viability [review]
18310288 N-ras mutation is associated with familial non-medullary thyroid carcinoma
18227705 NRAS mutation is not associated with cutaneous melanoma
18008004 mutation of N-RAS or B-RAF, signature genetic lesions present in most MMs, potently induced the expression of cell-surface CD200, a repressor of DC function.
18006851 16k PRL inhibits cell migration by blocking the Ras-Tiam1-Rac1-Pak1 signaling pathway in endothelial cells
18000091 Observational study of gene-disease association. (HuGE Navigator)
17960171 54% of childhood CBF-AML had RTKs and/or Ras mutations
17949898 Data indicate that a critical component of Ras signaling is the activation of PLD.
17943694 Observational study of genotype prevalence. (HuGE Navigator)
17910045 Observational study of gene-disease association. (HuGE Navigator)
17910045 Frequently mutated in high hyperdiploid childhood acute lymphoblastic leukemia.
17900235 expression of RET, nuclearRAS, and ERK proteins is greatly enhanced in papillary thyroid carcinoma cells and Hashimoto's thyroiditis oxyphil cells.
17893876 CD155, at least in part, enhances the proliferation of ras-mutated cells
17786355 Ras mutations were found in 33% of the papillary thyroid carcinomas
17712732 No mutations in NRAS was found in pilocytic astrocytomas.
17671710 Nras gene mutation might be one of the mechanisms of oncogenesis of lung adenocarcinoma.
17550846 Observational study of genotype prevalence. (HuGE Navigator)
17517660 observations on the effects of NRAS activation indicate that RAS-inactivating drugs, such as farnesyltransferase inhibitors should be examined in human autoimmune and lymphocyte homeostasis disorders
17507627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17507627 data indicate that both early-life UV exposure and nevus propensity contribute to occurrence of BRAF+ melanoma, whereas nevus propensity and later-life sun exposure influence the occurrence of NRAS+ melanoma
17332249 patients having juvenile myelomonocytic leukemia with NRAS or KRAS2 glycine to serine substitution received no chemotherapy, but hematologic improvement was observed during a 2- to 4-year follow up
17297468 Our data suggest that the activity of specific RAS isoforms is context-dependent and provide a possible explanation for the prevalence of NRAS mutations in melanoma.
17119447 NRAS mutations were associated with a significantly higher Clark level of invasion in melanoma tumours
17036375 Ras gene mutations, mostly involving the N-Ras gene, were detected in 20% of the multiple myeloma patients; Ras gene mutations are not likely to represent a master lesion in MM
16847854 The chemical properties and stucture of the membrane bound C-terminus of N-ras is reported.
16845322 NRAS mutation is associated with melanoma and melanocytic nevi.
16761621 ras may be involved in early stages of larynx carcinogenesis and may be activated by other mechanisms different from mutations, such as epigenetic events
16573741 In 239 Thai adult AML cases, 35 RAS mutations were found in 32 cases (13%) predominantly classified as M1/M2 (53%) followed by M4/M5 (38%). Ten cases were positive for NRAS codon 12, 11 for NRAS codon 61, 13 for NRAS codon 13, and one for KRAS codon 13.
16462768 NRAS and BRAF activating mutations can coexist in the same melanoma, but are mutually exclusive at the single-cell level
16142319 Ras mutations do not play a significant role in the pathogenesis of multiple myeloma in the Spanish population
16135812 Overactivation of N-Ras61K induces cytoplasmic mislocalization of p27 and disrupts TGF-beta-mediated Smad nuclear translocation by activation of the Mek/Erk pathway.
16098042 Observational study of gene-disease association. (HuGE Navigator)
16098042 Although BRAF and NRAS mutations are likely to be important for the initiation and maintenance of some melanomas, other factors might be more significant for proliferation and prognosis in subgroups of aggressive melanoma
16076867 Observational study of genotype prevalence. (HuGE Navigator)
15688405 oncogenic NRAS is important for avoidance of apoptosis in melanomas that harbor the codon 61 NRAS mutation
15674343 NRAS mutations are frequent in acute myeloblastic leukemia with normal karyotype.
15531466 Observational study of gene-disease association. (HuGE Navigator)
15474158 Low frequency of NRAS and KRAS2 gene mutations in childhood myelodysplastic syndromes.
15060167 Data show that Golgi-associated N-Ras is the critical Ras isoform and intracellular pool for low-grade T cell receptor signaling in Jurkat T cells.
14961576 Mutations in N-ras gene is associated with malignant melanomas
14737077 Acquisition of N-ras mutation is frequently associated with progression of myelodysplastic syndrome to acute myeloid leukemia
14695152 NRAS and BRAF mutations arise early during melanoma pathogenesis and are preserved throughout tumor progression
14688017 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12783933 high frequency of NRAS codon 61 mutations detected in primary hereditary melanomas may be the result of a hypermutability phenotype associated with a hereditary predisposition for melanoma development in patients with germline CDKN2A mutations
12637339 HDL induced a potent signal through a Ras/MAPK pathway mediated by a pertussis toxin-sensitive G-protein coupled receptor to the angiogenic phenotype in HCECs.
12483530 role of interleukin-6 in activation of expression
12393454 Protein kinase C mediates mutant N-Ras-induced developmental abnormalities erythropoiesis, giving rise to phenotypic and functional abnormalities commonly observed in preleukemia.
12230495 Regulation of Fas-mediated apoptosis by N-ras in melanoma.
12082607 BMECs co-expressing SV40T, hTERT and N-ras exhibited an overtly transformed phenotype; forming very large colonies with an altered morphology and generating rapidly growing tumours in vivo.
11524732 Mutations were detected by using allele-specific amplification method.
9344703 HIV-1 Nef-induced relocalization of LCK is correlated with N-Ras activation at recycling endosome/TGN compartments
9269777 HIV-1 Nef-induced relocalization of LCK is correlated with N-Ras activation at recycling endosome/TGN compartments

AA Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ      1 - 70
YMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIP     71 - 140
FIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM                         141 - 189
//

Text Mined References (367)

PMID Year Title
26807515 2016 Histologic and Phenotypic Factors and MC1R Status Associated with BRAF(V600E), BRAF(V600K), and NRAS Mutations in a Community-Based Sample of 414 Cutaneous Melanomas.
26701913 2015 ABHD17 proteins are novel protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization.
26597176 2015 Somatic and germline analyses of a long term melanoma survivor with a recurrent brain metastasis.
26581482 2015 Focused molecular analysis of small cell lung cancer: feasibility in routine clinical practice.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26562020 2015 SNPase-ARMS qPCR: Ultrasensitive Mutation-Based Detection of Cell-Free Tumor DNA in Melanoma Patients.
26560143 2015 Absolute Quantification of Endogenous Ras Isoform Abundance.
26547258 2015 Detectable FLT3-ITD or RAS mutation at the time of transformation from MDS to AML predicts for very poor outcomes.
26515069 2015 Neutron Crystal Structure of RAS GTPase Puts in Question the Protonation State of the GTP ?-Phosphate.
26471487 2016 Mutation Spectra of Common Cancer-Associated Genes in Different Phenotypes of Colorectal Carcinoma Without Distant Metastasis.
26467218 2015 Mutation in NRAS in familial Noonan syndrome--case report and review of the literature.
26440707 2016 Sensitivity of plasma BRAFmutant and NRASmutant cell-free DNA assays to detect metastatic melanoma in patients with low RECIST scores and non-RECIST disease progression.
26426340 2015 Analysis of BRAF and NRAS Mutation Status in Advanced Melanoma Patients Treated with Anti-CTLA-4 Antibodies: Association with Overall Survival?
26393682 2015 The association between let-7, RAS and HIF-1? in Ewing Sarcoma tumor growth.
26325669 2015 Src inhibitors act through different mechanisms in Non-Small Cell Lung Cancer models depending on EGFR and RAS mutational status.
26318427 2015 New findings on primary and acquired resistance to anti-EGFR therapy in metastatic colorectal cancer: do all roads lead to RAS?
26305188 2015 Molecular characterization of a selected cohort of patients affected by pulmonary metastases of malignant melanoma: Hints from BRAF, NRAS and EGFR evaluation.
26297254 2015 Dual NRASQ61R and BRAFV600E mutation-specific immunohistochemistry completes molecular screening in melanoma samples in a routine practice.
26282084 2015 Clinical characteristics associated with BRAF, NRAS and KIT mutations in Japanese melanoma patients.
26272610 2015 Catalysis of GTP hydrolysis by small GTPases at atomic detail by integration of X-ray crystallography, experimental, and theoretical IR spectroscopy.
26253102 2015 The variable phenotype and low-risk nature of RAS-positive thyroid nodules.
26225944 2015 Malignant Melanoma of Vulva and Vagina: A Histomorphological Review and Mutation Analysis--A Single-Center Study.
26222068 2015 Analysis of KRAS and NRAS Gene Mutations in Arab Asian Children With Acute Leukemia: High Frequency of RAS Mutations in Acute Lymphoblastic Leukemia.
26220150 2015 Extended RAS analysis for anti-epidermal growth factor therapy in patients with metastatic colorectal cancer.
26181424 2015 Trametinib-induced Left Ventricular Dysfunction in a Child With Relapsed Neuroblastoma.
26146664 2015 Association Between NRAS and BRAF Mutational Status and Melanoma-Specific Survival Among Patients With Higher-Risk Primary Melanoma.
26096079 2015 Gaining momentum: New options and opportunities for the treatment of advanced melanoma.
26090869 2015 Molecular spectrum of BRAF, NRAS and KRAS gene mutations in plasma cell dyscrasias: implication for MEK-ERK pathway activation.
26049686 2015 Prevalence of RAS mutations and individual variation patterns among patients with metastatic colorectal cancer: A pooled analysis of randomised controlled trials.
25999467 2015 Tyrosine phosphorylation of RAS by ABL allosterically enhances effector binding.
25999051 2015 Analysis of RAS mutation and PAX8/PPAR? rearrangements in follicular-derived thyroid neoplasms in a Korean population: frequency and ultrasound findings.
25997687 2015 RAS status in Korean patients with stage III and IV colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25926041 2015 Are all RAS mutations the same? Coexisting KRAS and NRAS mutations in a caecal adenocarcinoma and contiguous tubulovillous adenoma.
25920435 2015 Mutations in the RAS and PI3K pathways are associated with metastatic location in colorectal cancers.
25914220 2015 A postzygotic NRAS mutation in a patient with Schimmelpenning syndrome.
25901794 2015 Oncogenic NRAS Primes Primary Acute Myeloid Leukemia Cells for Differentiation.
25896945 2015 Somatic mosaicism for a NRAS mutation associates with disparate clinical features in RAS-associated leukoproliferative disease: a report of two cases.
25886136 2015 A retrospective observational study of clinicopathological features of KRAS, NRAS, BRAF and PIK3CA mutations in Japanese patients with metastatic colorectal cancer.
25858894 2015 Low frequency of mutations in Chinese with acute myeloid leukemia: Different disease or different aetiology?
25851630 2015 Heterogeneity of KRAS, NRAS, BRAF and PIK3CA mutations in metastatic colorectal cancer and potential effects on therapy in the CAPRI GOIM trial.
25815427 2015 Acute Inhibition of MEK Suppresses Congenital Melanocytic Nevus Syndrome in a Murine Model Driven by Activated NRAS and Wnt Signaling.
25796376 2015 Treatment of NRAS-mutant melanoma.
25749811 2015 Sensitivity of Melanoma Cells to EGFR and FGFR Activation but Not Inhibition is Influenced by Oncogenic BRAF and NRAS Mutations.
25736262 2015 Impact of NRAS mutations for patients with advanced melanoma treated with immune therapies.
25722211 2015 A Murine Model for Metastatic Conjunctival Melanoma.
25695684 2015 Somatic Activating RAS Mutations Cause Vascular Tumors Including Pyogenic Granuloma.
25666295 2015 FOLFOX4 Plus Cetuximab for Patients With Previously Untreated Metastatic Colorectal Cancer According to Tumor RAS and BRAF Mutation Status: Updated Analysis of the CECOG/CORE 1.2.002 Study.
25659223 2015 Immunohistochemistry as a potential tool for routine detection of the NRAS Q61R mutation in patients with metastatic melanoma.
25645078 2015 Combination of pan-RAF and MEK inhibitors in NRAS mutant melanoma.
25627962 2015 Activating PIK3CA mutations coexist with BRAF or NRAS mutations in a limited fraction of melanomas.
25491172 2015 RAS mutations affect pattern of metastatic spread and increase propensity for brain metastasis in colorectal cancer.
25385688 2015 BRAF, NRAS and MC1R status in a prospective series of primary cutaneous melanoma.
25373533 2015 Updated guidelines for biomarker testing in colorectal carcinoma: a national consensus of the Spanish Society of Pathology and the Spanish Society of Medical Oncology.
25363723 2015 Comparative analysis of BRAF, NRAS and c-KIT mutation status between tumor tissues and autologous tumor cell-lines of stage III/IV melanoma.
25361812 2014 Preclinical efficacy of MEK inhibition in Nras-mutant AML.
25337237 2014 Comparison of neuroendocrine differentiation and KRAS/NRAS/BRAF/PIK3CA/TP53 mutation status in primary and metastatic colorectal cancer.
25316818 2014 Genomic classification of serous ovarian cancer with adjacent borderline differentiates RAS pathway and TP53-mutant tumors and identifies NRAS as an oncogenic driver.
25316678 2014 NRASG12V oncogene facilitates self-renewal in a murine model of acute myelogenous leukemia.
25263998 2014 Mutated and amplified NRAS in a subset of cutaneous melanocytic lesions with dermal spitzoid morphology: report of two pediatric cases located on the ear.
25252692 2014 Mutation-specific RAS oncogenicity explains NRAS codon 61 selection in melanoma.
25227306 2015 RAS mutations predict radiologic and pathologic response in patients treated with chemotherapy before resection of colorectal liver metastases.
25204082 2014 NRAS mutations in de novo acute leukemia: prevalence and clinical significance.
25164765 2014 Comparative sequencing analysis reveals high genomic concordance between matched primary and metastatic colorectal cancer lesions.
25158650 2015 The differential palmitoylation states of N-Ras and H-Ras determine their distinct Golgi subcompartment localizations.
25157176 2014 Src promotes GTPase activity of Ras via tyrosine 32 phosphorylation.
25150293 2014 Recurrent RAS and PIK3CA mutations in Erdheim-Chester disease.
25109485 2015 RAS mutations in indeterminate thyroid nodules are predictive of the follicular variant of papillary thyroid carcinoma.
25105841 2014 Frequent cases of RAS-mutated Down syndrome acute lymphoblastic leukaemia lack JAK2 mutations.
25063807 2014 Mitogen-activated protein kinase (MAPK) hyperactivation and enhanced NRAS expression drive acquired vemurafenib resistance in V600E BRAF melanoma cells.
25048604 2014 Association between BRAFV600E and NRASQ61R mutations and clinicopathologic characteristics, risk factors and clinical outcome of primary invasive cutaneous melanoma.
25009008 2014 Clinicopathologic characteristics and gene expression analyses of non-KRAS 12/13, RAS-mutated metastatic colorectal cancer.
24962318 2014 Targeting TBK1 inhibits migration and resistance to MEK inhibitors in mutant NRAS melanoma.
24950457 2014 Amuvatinib has cytotoxic effects against NRAS-mutant melanoma but not BRAF-mutant melanoma.
24941944 2014 Differential chemosensitivity to antifolate drugs between RAS and BRAF melanoma cells.
24918823 2014 Correlation of BRAF and NRAS mutation status with outcome, site of distant metastasis and response to chemotherapy in metastatic melanoma.
24906137 2014 The epigenetic regulator I-BET151 induces BIM-dependent apoptosis and cell cycle arrest of human melanoma cells.
24866436 2014 Molecular characterization and patient outcome of melanoma nodal metastases and an unknown primary site.
24859998 2014 KRAS, NRAS and BRAF mutations in Greek and Romanian patients with colorectal cancer: a cohort study.
24820091 2014 NRAS codon 61 mutation is associated with distant metastasis in patients with follicular thyroid carcinoma.
24806883 2014 Clinicopathological characteristics and prognostic impact of colorectal cancers with NRAS mutations.
24806288 2015 Role of NRAS mutations as prognostic and predictive markers in metastatic colorectal cancer.
24802725 2014 NRAS mutations are more prevalent than KIT mutations in melanoma of the female urogenital tract--a study of 24 cases from the Netherlands.
24798740 2014 Concomitant RAS, RET/PTC, or BRAF mutations in advanced stage of papillary thyroid carcinoma.
24774510 2014 Clinicopathological features and prognostic roles of KRAS, BRAF, PIK3CA and NRAS mutations in advanced gastric cancer.
24758538 2014 The Emerging Role of NRAS Mutations in Colorectal Cancer Patients Selected for Anti-EGFR Therapies.
24737308 2014 Lack of noncanonical RAS mutations in cytogenetically normal acute myeloid leukemia.
24714776 2014 Correlation of somatic mutations and clinical outcome in melanoma patients treated with Carboplatin, Paclitaxel, and sorafenib.
24710085 2015 BRAF and NRAS mutations are heterogeneous and not mutually exclusive in nodular melanoma.
24703650 2014 [Neurocutaneous melanosis and multiple congenital melanocytic naevi are associated with post-zygotic N-ras mutations].
24691006 2014 Gain of ALK gene copy number may predict lack of benefit from anti-EGFR treatment in patients with advanced colorectal cancer and RAS-RAF-PI3KCA wild-type status.
24666267 2014 The predictive value of KRAS, NRAS, BRAF, PIK3CA and PTEN for anti-EGFR treatment in metastatic colorectal cancer: A systematic review and meta-analysis.
24610751 2014 Concurrent juvenile myelomonocytic leukemia and T-lymphoblastic lymphoma with a shared missense mutation in NRAS.
24603591 2014 Comparison of molecular abnormalities in vulvar and vaginal melanomas.
24590757 2014 Control of thrombotic thrombocytopenic purpura by sirolimus in a child with juvenile myelomonocytic leukemia and somatic N-RAS mutation.
24588908 2014 MEK targeting in N-RAS mutated metastatic melanoma.
24586049 2014 NRAS isoforms differentially affect downstream pathways, cell growth, and cell transformation.
24509877 2014 MAF mediates crosstalk between Ras-MAPK and mTOR signaling in NF1.
24335104 2014 Mutation of NRAS but not KRAS significantly reduces myeloma sensitivity to single-agent bortezomib therapy.
24222113 2013 Comprehensive survey of HRAS, KRAS, and NRAS mutations in proliferative thyroid lesions from an ethnically diverse population.
24189344 2014 Common genetic variants on 1p13.2 associate with risk of autism.
24166518 2013 Toward a NOTCH1/FBXW7/RAS/PTEN-based oncogenetic risk classification of adult T-cell acute lymphoblastic leukemia: a Group for Research in Adult Acute Lymphoblastic Leukemia study.
24129063 2014 NRAS mutation is the sole recurrent somatic mutation in large congenital melanocytic nevi.
24067137 2014 Impact of mutations in FLT3, PTPN11 and RAS genes on the overall survival of pediatric B cell precursor acute lymphoblastic leukemia in Brazil.
24024839 2013 Panitumumab-FOLFOX4 treatment and RAS mutations in colorectal cancer.
24018645 2013 RAS mutation status predicts survival and patterns of recurrence in patients undergoing hepatectomy for colorectal liver metastases.
24006859 2013 Simultaneous identification of 36 mutations in KRAS codons 61 and 146, BRAF, NRAS, and PIK3CA in a single reaction by multiplex assay kit.
24006476 2014 Multilineage somatic activating mutations in HRAS and NRAS cause mosaic cutaneous and skeletal lesions, elevated FGF23 and hypophosphatemia.
23993026 2013 KIT, NRAS, BRAF and PTEN mutations in a sample of Swedish patients with acral lentiginous melanoma.
23987572 2013 Heterogeneous distribution of BRAF/NRAS mutations among Italian patients with advanced melanoma.
23922205 2013 Clinical characteristics and outcomes with specific BRAF and NRAS mutations in patients with metastatic melanoma.
23861977 2013 NRAS and BRAF mutations in melanoma-associated nevi and uninvolved nevi.
23860532 2013 KIT, NRAS and BRAF mutations in sinonasal mucosal melanoma: a study of 56 cases.
23855428 2013 The clinical significance of BRAF and NRAS mutations in a clinic-based metastatic melanoma cohort.
23833303 2013 BRAF/NRAS wild-type melanomas have a high mutation load correlating with histologic and molecular signatures of UV damage.
23821376 2014 Lack of KRAS, NRAS, BRAF and TP53 mutations improves outcome of elderly metastatic colorectal cancer patients treated with cetuximab, oxaliplatin and UFT.
23795354 2013 [Characterization of genetic alterations in primary human melanomas carrying BRAF or NRAS mutation].
23782496 2013 KIT, NRAS, and BRAF mutations in nail apparatus melanoma.
23774633 2013 Dynamic acquisition of FLT3 or RAS alterations drive a subset of patients with lower risk MDS to secondary AML.
23771122 2014 Somatic BRAF and NRAS mutations in familial melanomas with known germline CDKN2A status: a GenoMEL study.
23758196 2013 Ras palmitoylation is necessary for N-Ras activation and signal propagation in growth factor signalling.
23739925 2014 NRAS mutations in primary and metastatic melanomas of Japanese patients.
23708912 2013 NRAS mutations with low allele burden have independent prognostic significance for patients with lower risk myelodysplastic syndromes.
23687087 2013 Nras(G12D/+) promotes leukemogenesis by aberrantly regulating hematopoietic stem cell functions.
23673558 2013 Low BRAF and NRAS expression levels are associated with clinical benefit from DTIC therapy and prognosis in metastatic melanoma.
23667841 2013 N-ras mutation detection by pyrosequencing in adult patients with acute myeloid leukemia at a single institution.
23664541 2013 Oncogene abnormalities in a series of primary melanomas of the sinonasal tract: NRAS mutations and cyclin D1 amplification are more frequent than KIT or BRAF mutations.
23633454 2013 Conjunctival melanomas harbor BRAF and NRAS mutations and copy number changes similar to cutaneous and mucosal melanomas.
23538902 2013 Inhibition of Wee1, AKT, and CDK4 underlies the efficacy of the HSP90 inhibitor XL888 in an in vivo model of NRAS-mutant melanoma.
23536553 2013 Oncogenic NRAS, required for pathogenesis of embryonic rhabdomyosarcoma, relies upon the HMGA2-IGF2BP2 pathway.
23515407 2013 Characteristics of lung cancers harboring NRAS mutations.
23496764 2013 A requirement for wild-type Ras isoforms in mutant KRas-driven signalling and transformation.
23477374 2013 Molecular alterations in partially-encapsulated or well-circumscribed follicular variant of papillary thyroid carcinoma.
23448684 2013 Prevalence of BRAF and NRAS mutations in fast-growing melanomas.
23423222 2013 RAS/MEK-independent gene expression reveals BMP2-related malignant phenotypes in the Nf1-deficient MPNST.
23403319 2013 Frequencies and prognostic impact of RAS mutations in MLL-rearranged acute lymphoblastic leukemia in infants.
23392294 2013 Multiple congenital melanocytic nevi and neurocutaneous melanosis are caused by postzygotic mutations in codon 61 of NRAS.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362874 2013 Genetic alterations in RAS-regulated pathway in acral lentiginous melanoma.
23313659 2013 RAS mutation analysis in a large cohort of Chinese patients with acute myeloid leukemia.
23303902 2013 Primary melanoma of the CNS in children is driven by congenital expression of oncogenic NRAS in melanocytes.
23262097 2012 [The cooperation between p53 and Ras in tumorigenesis].
23240926 2013 Evidence of a low prevalence of RAS mutations in a large medullary thyroid cancer series.
23233531 2013 miR148b is a major coordinator of breast cancer progression in a relapse-associated microRNA signature by targeting ITGA5, ROCK1, PIK3CA, NRAS, and CSF1.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23201159 2013 Downregulation of miR-145 associated with cancer progression and VEGF transcriptional activation by targeting N-RAS and IRS1.
23153525 2013 Localization of the NRAS:BCL-2 complex determines anti-apoptotic features associated with progressive disease in myelodysplastic syndromes.
23096702 2013 NRAS and BRAF mutations in cutaneous melanoma and the association with MC1R genotype: findings from Spanish and Austrian populations.
23076151 2012 SHOC2 and CRAF mediate ERK1/2 reactivation in mutant NRAS-mediated resistance to RAF inhibitor.
23000456 2012 Functional status and relationships of melanocortin 1 receptor signaling to the cAMP and extracellular signal-regulated protein kinases 1 and 2 pathways in human melanoma cells.
22997201 2012 Absence of oncogenic canonical pathway mutations in aggressive pediatric rhabdoid tumors.
22983396 2012 Oncogenic NRAS signaling differentially regulates survival and proliferation in melanoma.
22974165 2012 Expression of c-Jun, p73, Casp9, and N-ras in thymic epithelial tumors: relationship with the current WHO classification systems.
22931913 2013 BRAF mutation, NRAS mutation, and the absence of an immune-related expressed gene profile predict poor outcome in patients with stage III melanoma.
22926523 2013 GAB2 induces tumor angiogenesis in NRAS-driven melanoma.
22912864 2012 Novel somatic mutations to PI3K pathway genes in metastatic melanoma.
22887781 2012 Constitutional NRAS mutations are rare among patients with Noonan syndrome or juvenile myelomonocytic leukemia.
22820081 The mutational spectrum of HRAS, KRAS, NRAS and FGFR3 genes in bladder cancer.
22809251 2012 BRAF, NRAS and KIT sequencing analysis of spindle cell melanoma.
22773810 2012 Lung cancers with acquired resistance to EGFR inhibitors occasionally harbor BRAF gene mutations but lack mutations in KRAS, NRAS, or MEK1.
22758774 2013 GNA11 and N-RAS mutations: alternatives for MAPK pathway activating GNAQ mutations in primary melanocytic tumours of the central nervous system.
22753870 2012 Somatic mosaicism for oncogenic NRAS mutations in juvenile myelomonocytic leukemia.
22650231 2012 The associations between RAS mutations and clinical characteristics in follicular thyroid tumors: new insights from a single center and a large patient cohort.
22614978 2012 BRAF/NRAS mutation frequencies among primary tumors and metastases in patients with melanoma.
22589270 2012 A comprehensive survey of Ras mutations in cancer.
22499344 2012 Keratinocytic epidermal nevi are associated with mosaic RAS mutations.
22456166 2012 Marked genetic differences between BRAF and NRAS mutated primary melanomas as revealed by array comparative genomic hybridization.
22427190 Combined mutational analysis of KRAS, NRAS and BRAF genes in Indian patients with colorectal carcinoma.
22407852 2012 RAS mutations are frequent in FAB type M4 and M5 of acute myeloid leukemia, and related to late relapse: a study of the Japanese Childhood AML Cooperative Study Group.
22199277 2011 Mutational screening of RET, HRAS, KRAS, NRAS, BRAF, AKT1, and CTNNB1 in medullary thyroid carcinoma.
22180178 2012 NRAS mutation status is an independent prognostic factor in metastatic melanoma.
22130161 2012 Correlation of NRAS mutations with clinical response to high-dose IL-2 in patients with advanced melanoma.
22120021 2012 Targeted overexpression of an activated N-ras gene results in B-cell and plasma cell lymphoproliferation and cooperates with c-myc to induce fatal B-cell neoplasia.
22020736 2012 Association of activated c-Met with NRAS-mutated human melanomas.
21968647 2012 PAQR10 and PAQR11 mediate Ras signaling in the Golgi apparatus.
21908617 2011 Differential regulation of N-Myc and c-Myc synthesis, degradation, and transcriptional activity by the Ras/mitogen-activated protein kinase pathway.
21809347 2012 Wild type N-ras displays anti-malignant properties, in part by downregulating decorin.
21796448 2011 The preeminence of growth pattern and invasiveness and the limited influence of BRAF and RAS mutations in the occurrence of papillary thyroid carcinoma lymph node metastases.
21788131 2012 Prevalence of BRAF V600E mutation in Chinese melanoma patients: large scale analysis of BRAF and NRAS mutations in a 432-case cohort.
21757746 2011 Cholangiocyte N-Ras protein mediates lipopolysaccharide-induced interleukin 6 secretion and proliferation.
21750866 2011 NRAS and BRAF mutation frequency in primary oral mucosal melanoma.
21615881 2011 Clinical outcome and pathological features associated with NRAS mutation in cutaneous melanoma.
21595878 2011 Effect of human activated NRAS on replication of delNS1 H5N1 influenza virus in MDCK cells.
21586752 2011 Endogenous oncogenic Nras mutation initiates hematopoietic malignancies in a dose- and cell type-dependent manner.
21430505 2011 Lack of BRAF(V600E) mutations in giant congenital melanocytic nevi in a Chinese population.
21358716 2011 Prevalence and clinical implications of NRAS mutations in childhood AML: a report from the Children's Oncology Group.
21305640 2011 Frequency of KRAS, BRAF, and NRAS mutations in colorectal cancer.
21283084 2011 The inv(3)(q21q26)/t(3;3)(q21;q26) is frequently accompanied by alterations of the RUNX1, KRAS and NRAS and NF1 genes and mediates adverse prognosis both in MDS and in AML: a study in 39 cases of MDS or AML.
21278800 2011 RASSF7 negatively regulates pro-apoptotic JNK signaling by inhibiting the activity of phosphorylated-MKK7.
21269460 2011 Initial characterization of the human central proteome.
21263000 2011 Noonan syndrome gain-of-function mutations in NRAS cause zebrafish gastrulation defects.
21209378 2011 High-throughput mutation profiling of CTCL samples reveals KRAS and NRAS mutations sensitizing tumors toward inhibition of the RAS/RAF/MEK signaling cascade.
21200020 2011 N-Ras(G12D) induces features of stepwise transformation in preleukemic human umbilical cord blood cultures expressing the AML1-ETO fusion gene.
21168197 2011 Tissue-specific signatures of activating PIK3CA and RAS mutations in carcinosarcomas of gynecologic origin.
21166657 2011 Frequencies of BRAF and NRAS mutations are different in histological types and sites of origin of cutaneous melanoma: a meta-analysis.
21134978 2011 Clonal analysis of NRAS activating mutations in KIT-D816V systemic mastocytosis.
21131919 2011 Genetic aberrations in primary esophageal melanomas: molecular analysis of c-KIT, PDGFR, KRAS, NRAS and BRAF in a series of 10 cases.
21107323 2010 Melanomas acquire resistance to B-RAF(V600E) inhibition by RTK or N-RAS upregulation.
21072204 2010 FGFR3, HRAS, KRAS, NRAS and PIK3CA mutations in bladder cancer and their potential as biomarkers for surveillance and therapy.
20975100 2011 Clinical correlates of NRAS and BRAF mutations in primary human melanoma.
20881644 2010 Somatic mutations in epidermal growth factor receptor signaling pathway genes in non-small cell lung cancers.
20880116 2010 ASXL1 mutation is associated with poor prognosis and acute transformation in chronic myelomonocytic leukaemia.
20860430 2010 Molecular, morphologic, and outcome analysis of thyroid carcinomas according to degree of extrathyroid extension.
20824703 2011 Integrated genetic and epigenetic analysis of bladder cancer reveals an additive diagnostic value of FGFR3 mutations and hypermethylation events.
20815269 2010 [Study on the effect of Yiqi Yangyin Recipe and its different assembling on expressions of Flt3 and N-ras in acute myeloid leukemic cells].
20736745 2010 NRAS mutations are rare in colorectal cancer.
20726318 2009 Prognostic implication of N-RAS gene mutations in Egyptian adult acute myeloid leukemia.
20720566 2010 Association between the germline MC1R variants and somatic BRAF/NRAS mutations in melanoma tumors.
20713885 2010 TCR-induced activation of Ras proceeds at the plasma membrane and requires palmitoylation of N-Ras.
20703244 2010 High frequency of p16(INK4A) promoter methylation in NRAS-mutated cutaneous melanoma.
20680410 2010 The role of neurofibromin in N-Ras mediated AP-1 regulation in malignant peripheral nerve sheath tumors.
20678218 2010 Combined mutations of ASXL1, CBL, FLT3, IDH1, IDH2, JAK2, KRAS, NPM1, NRAS, RUNX1, TET2 and WT1 genes in myelodysplastic syndromes and acute myeloid leukemias.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619739 2010 Effects of KRAS, BRAF, NRAS, and PIK3CA mutations on the efficacy of cetuximab plus chemotherapy in chemotherapy-refractory metastatic colorectal cancer: a retrospective consortium analysis.
20526288 2010 Molecular genotyping of papillary thyroid carcinoma follicular variant according to its histological subtypes (encapsulated vs infiltrative) reveals distinct BRAF and RAS mutation patterns.
20520634 2010 Mutation analysis for RUNX1, MLL-PTD, FLT3-ITD, NPM1 and NRAS in 269 patients with MDS or secondary AML.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20392691 2010 Induction of the apoptosis inhibitor ARC by Ras in human cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20371679 2010 RAS mutations contribute to evolution of chronic myelomonocytic leukemia to the proliferative variant.
20237506 2010 Relapsed childhood high hyperdiploid acute lymphoblastic leukemia: presence of preleukemic ancestral clones and the secondary nature of microdeletions and RTK-RAS mutations.
20192584 2009 Screening of N-ras gene mutations in urothelial cell carcinomas of the urinary bladder in the Kashmiri population.
20157749 2010 K-ras mutation in the major duodenal papilla and gastric and colonic mucosa in patients with autoimmune pancreatitis.
20150643 2010 Absence of oncogenic mutations of RAS family genes in soft tissue sarcomas of 100 Japanese patients.
20147298 2010 The deubiquitinating enzyme USP17 blocks N-Ras membrane trafficking and activation but leaves K-Ras unaffected.
20140953 2010 Deletion at chromosome arm 9p in relation to BRAF/NRAS mutations and prognostic significance for primary melanoma.
20098682 2010 Two multiplex assays that simultaneously identify 22 possible mutation sites in the KRAS, BRAF, NRAS and PIK3CA genes.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20012784 2010 Absence of BRAF, NRAS, KRAS, HRAS mutations, and RET/PTC gene rearrangements distinguishes dominant nodules in Hashimoto thyroiditis from papillary thyroid carcinomas.
19966803 2010 A restricted spectrum of NRAS mutations causes Noonan syndrome.
19954345 2009 Oncogenic NRAS cooperates with p53 loss to generate melanoma in zebrafish.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874312 2010 Quantitative assessment of PTPN11 or RAS mutations at the neonatal period and during the clinical course in patients with juvenile myelomonocytic leukaemia.
19865112 2010 Mutual exclusion of ASXL1 and NPM1 mutations in a series of acute myeloid leukemias.
19833857 2009 RAS and CSF3R mutations in severe congenital neutropenia.
19819220 2010 Backbone conformational flexibility of the lipid modified membrane anchor of the human N-Ras protein investigated by solid-state NMR and molecular dynamics simulation.
19802003 2010 c-Kit mutants require hypoxia-inducible factor 1alpha to transform melanocytes.
19789336 2009 RAS mutations affect tumor necrosis factor-induced apoptosis in colon carcinoma cells via ERK-modulatory negative and positive feedback circuits along with non-ERK pathway effects.
19765726 2010 Multiple genetic alterations in papillary thyroid cancer are associated with younger age at presentation.
19759551 2010 Coexisting NRAS and BRAF mutations in primary familial melanomas with specific CDKN2A germline alterations.
19718661 2009 Effect on the Ras/Raf signaling pathway of post-translational modifications of neurofibromin: in silico study of protein modification responsible for regulatory pathways.
19705759 [Analysis of changes induced by oncogene N-RAS expression in pattern and distribution of pseudopodial activity of fibroblasts].
19633643 2009 Characterization of candidate gene copy number alterations in the 11q13 region along with BRAF and NRAS mutations in human melanoma.
19492075 2009 Combined targeting of BRAF and CRAF or BRAF and PI3K effector pathways is required for efficacy in NRAS mutant tumors.
19487299 2009 Mutational profile of advanced primary and metastatic radioactive iodine-refractory thyroid cancers reveals distinct pathogenetic roles for BRAF, PIK3CA, and AKT1.
19383313 2008 Human cutaneous melanoma; a review of NRAS and BRAF mutation frequencies in relation to histogenetic subclass and body site.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19319568 2009 Esophageal melanomas harbor frequent NRAS mutations unlike melanomas of other mucosal sites.
19309322 2009 Comprehensive analysis of cooperative gene mutations between class I and class II in de novo acute myeloid leukemia.
19303097 2009 Activation of RAS family genes in urothelial carcinoma.
19190079 2009 Mutational analysis of the BRAF, RAS and EGFR genes in human adrenocortical carcinomas.
19101897 2008 Mutations of RAS gene family in specimens of bladder cancer.
19047918 2009 Correlation of clinical features with the mutational status of GM-CSF signaling pathway-related genes in juvenile myelomonocytic leukemia.
19037234 2009 Frequencies of NRAS and BRAF mutations increase from the radial to the vertical growth phase in cutaneous melanoma.
18980976 2008 KIT gene mutations and copy number in melanoma subtypes.
18945298 2009 RAS and RAF mutations in banal melanocytic aggregates contiguous with primary cutaneous melanoma: clues to melanomagenesis.
18814281 2009 Oncogenic NRAS has multiple effects on the malignant phenotype of human melanoma cells cultured in vitro.
18788612 2008 [N-ras and fms gene mutation in idiopathic thrombocytopenic purpura and myelodysplasia].
18760455 2008 Stimulation of human mast cells by activated T cells leads to N-Ras activation through Ras guanine nucleotide releasing protein 1.
18701506 2008 Mutation of genes affecting the RAS pathway is common in childhood acute lymphoblastic leukemia.
18668139 2009 Active N-Ras and B-Raf inhibit anoikis by downregulating Bim expression in melanocytic cells.
18641128 2008 Endothelial nitric oxide synthase regulates N-Ras activation on the Golgi complex of antigen-stimulated T cells.
18633438 2009 Genotypic and gene expression studies in congenital melanocytic nevi: insight into initial steps of melanotumorigenesis.
18632627 2008 Identification of a novel subgroup of melanomas with KIT/cyclin-dependent kinase-4 overexpression.
18615679 2008 Novel V600E BRAF mutations in imatinib-naive and imatinib-resistant gastrointestinal stromal tumors.
18567617 2008 Silencing of N-Ras gene expression using shRNA decreases transformation efficiency and tumor growth in transformed cells induced by anti-BPDE.
18559876 2008 Patients with acute myeloid leukemia and RAS mutations benefit most from postremission high-dose cytarabine: a Cancer and Leukemia Group B study.
18450602 2008 Mutations and treatment outcome in cytogenetically normal acute myeloid leukemia.
18375819 2008 BRAF and NRAS mutations in melanoma: potential relationships to clinical response to HSP90 inhibitors.
18323787 2008 Phospho-ERK staining is a poor indicator of the mutational status of BRAF and NRAS in human melanoma.
18316589 2008 Inhibition of the Ras-Net (Elk-3) pathway by a novel pyrazole that affects microtubules.
18316586 2008 CDC25A phosphatase: a rate-limiting oncogene that determines genomic stability.
18310288 2008 Familial non-medullary thyroid carcinoma (FNMTC): analysis of fPTC/PRN, NMTC1, MNG1 and TCO susceptibility loci and identification of somatic BRAF and RAS mutations.
18227705 2008 Mutation analysis of the EGFR-NRAS-BRAF pathway in melanomas from black Africans and other subgroups of cutaneous melanoma.
18008004 2007 CD200 is induced by ERK and is a potential therapeutic target in melanoma.
18006851 2007 16-kDa prolactin inhibits endothelial cell migration by down-regulating the Ras-Tiam1-Rac1-Pak1 signaling pathway.
18000091 2008 Clinicopathological analysis of papillary thyroid cancer with PIK3CA alterations in a Middle Eastern population.
17960171 2008 Cooperating mutations of receptor tyrosine kinases and Ras genes in childhood core-binding factor acute myeloid leukemia and a comparative analysis on paired diagnosis and relapse samples.
17949898 2007 Phospholipase D provides a survival signal in human cancer cells with activated H-Ras or K-Ras.
17943694 2007 Prevalence of RAS point mutations in papillary thyroid carcinoma; a novel mutation at codon 31 of K-RAS.
17910045 2008 Mutations of FLT3, NRAS, KRAS, and PTPN11 are frequent and possibly mutually exclusive in high hyperdiploid childhood acute lymphoblastic leukemia.
17900235 2007 High prevalence of RET, RAS, and ERK expression in Hashimoto's thyroiditis and in papillary thyroid carcinoma in the Korean population.
17893876 2008 The CD155/poliovirus receptor enhances the proliferation of ras-mutated cells.
17786355 2007 Comparative genomic hybridization, BRAF, RAS, RET, and oligo-array analysis in aneuploid papillary thyroid carcinomas.
17712732 2007 Further evidence for a somatic KRAS mutation in a pilocytic astrocytoma.
17671710 2007 Nras and Kras mutation in Japanese lung cancer patients: Genotyping analysis using LightCycler.
17550846 2007 A comparative study of molecular mutations in 381 patients with myelodysplastic syndrome and in 4130 patients with acute myeloid leukemia.
17517660 2007 NRAS mutation causes a human autoimmune lymphoproliferative syndrome.
17507627 2007 Number of nevi and early-life ambient UV exposure are associated with BRAF-mutant melanoma.
17332249 2007 Spontaneous improvement of hematologic abnormalities in patients having juvenile myelomonocytic leukemia with specific RAS mutations.
17297468 2007 Differential oncogenic potential of activated RAS isoforms in melanocytes.
17119447 2006 NRAS and BRAF mutations in melanoma tumours in relation to clinical characteristics: a study based on mutation screening by pyrosequencing.
17056636 2007 Expansion of the genotypic and phenotypic spectrum in patients with KRAS germline mutations.
17036375 2007 Relevance of Ras gene mutations in the context of the molecular heterogeneity of multiple myeloma.
16847854 2006 Structural model of the membrane-bound C terminus of lipid-modified human N-ras protein.
16845322 2006 BRAF and NRAS mutations in melanoma and melanocytic nevi.
16761621 2006 Mutational analysis of K-ras and Ras protein expression in larynx squamous cell carcinoma.
16737746 2006 The expression of the homologue of the Caenorhabditis elegans lin-45 raf is regulated in the motile stages of the plant parasitic nematode Meloidogyne artiellia.
16573741 2006 Frequency of RAS gene mutation and its cooperative genetic events in Southeast Asian adult acute myeloid leukemia.
16462768 2006 Mutually exclusive NRASQ61R and BRAFV600E mutations at the single-cell level in the same human melanoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16142319 2005 RAS mutations are uncommon in multiple myeloma and other monoclonal gammopathies.
16135812 2005 Pathway- and expression level-dependent effects of oncogenic N-Ras: p27(Kip1) mislocalization by the Ral-GEF pathway and Erk-mediated interference with Smad signaling.
16098042 2005 BRAF and NRAS mutations are frequent in nodular melanoma but are not associated with tumor cell proliferation or patient survival.
16076867 2005 Nucleophosmin gene mutations are predictors of favorable prognosis in acute myelogenous leukemia with a normal karyotype.
16000296 2005 DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras.
15766527 2005 RAS is regulated by the let-7 microRNA family.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15705808 2005 An acylation cycle regulates localization and activity of palmitoylated Ras isoforms.
15688405 2005 Suppression of oncogenic NRAS by RNA interference induces apoptosis of human melanoma cells.
15674343 2005 Distinct gene expression patterns associated with FLT3- and NRAS-activating mutations in acute myeloid leukemia with normal karyotype.
15531466 2004 Prognostic significance of N-RAS and K-RAS mutations in 232 patients with acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474158 2004 Low frequency of NRAS and KRAS2 gene mutations in childhood myelodysplastic syndromes.
15060167 2004 Ras activation in Jurkat T cells following low-grade stimulation of the T-cell receptor is specific to N-Ras and occurs only on the Golgi apparatus.
14961576 2004 Frequent alterations of Ras signaling pathway genes in sporadic malignant melanomas.
14737077 2004 Acquisition of FLT3 or N-ras mutations is frequently associated with progression of myelodysplastic syndrome to acute myeloid leukemia.
14695152 2003 NRAS and BRAF mutations arise early during melanoma pathogenesis and are preserved throughout tumor progression.
14688017 2004 Ras gene mutations in patients with acute myeloid leukaemia and exposure to chemical agents.
12783933 2003 Frequency of UV-inducible NRAS mutations in melanomas of patients with germline CDKN2A mutations.
12727991 2003 RAS point mutations and PAX8-PPAR gamma rearrangement in thyroid tumors: evidence for distinct molecular pathways in thyroid follicular carcinoma.
12637339 2003 High density lipoprotein-induced angiogenesis requires the activation of Ras/MAP kinase in human coronary artery endothelial cells.
12483530 2002 Activation of N-ras and K-ras induced by interleukin-6 in a myeloma cell line: implications for disease progression and therapeutic response.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393454 2002 Protein kinase C mediates mutant N-Ras-induced developmental abnormalities in normal human erythroid cells.
12230495 2002 Regulation of Fas-mediated apoptosis by N-ras in melanoma.
12082607 2002 Multiple stages of malignant transformation of human endothelial cells modelled by co-expression of telomerase reverse transcriptase, SV40 T antigen and oncogenic N-ras.
11948427 2002 SmgGDS displays differential binding and exchange activity towards different Ras isoforms.
11524732 2001 High incidence of N and K-Ras activating mutations in multiple myeloma and primary plasma cell leukemia at diagnosis.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
11332726 2001 Isolation and characterization of a symbiosis-regulated ras from the ectomycorrhizal fungus Laccaria bicolor.
10918068 2000 Characterization of RasGRP2, a plasma membrane-targeted, dual specificity Ras/Rap exchange factor.
10783161 2000 The leucine-rich repeat protein SUR-8 enhances MAP kinase activation and forms a complex with Ras and Raf.
10712923 2000 The Ras branch of small GTPases: Ras family members don't fall far from the tree.
10655059 2000 A genome-wide survey of RAS transformation targets.
10490827 1999 Bcl-2 differentially targets K-, N-, and H-Ras to mitochondria in IL-2 supplemented or deprived cells: implications in prevention of apoptosis.
10412982 1999 Endomembrane trafficking of ras: the CAAX motif targets proteins to the ER and Golgi.
9690470 1998 The structural basis of the activation of Ras by Sos.
9674433 1998 SUR-8, a conserved Ras-binding protein with leucine-rich repeats, positively regulates Ras-mediated signaling in C. elegans.
9578425 1997 UV-induced N-ras mutations are T-cell targets in human melanoma.
9488663 1998 Identification of Nore1 as a potential Ras effector.
9297626 1997 Ras effectors and their role in mitogenesis and oncogenesis.
9069267 1997 Signal transduction by the neurotrophin receptors.
9069260 1997 The complexity of Raf-1 regulation.
8665852 1996 Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation.
8607982 1995 Ras-related proteins in signal transduction and growth control.
8493579 1993 Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.
8280380 1993 Mutations of the p53 tumor suppressor gene and the ras gene family in intrahepatic cholangiocellular carcinomas in Japan and Thailand.
7972015 1994 Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7820549 1994 The activation of phosphatidylinositol 3-kinase by Ras.
7789166 1995 Determination of the gene order of the three loci CD2, NGFB, and NRAS at human chromosome band 1p13 and refinement of their localisation at the subband level by fluorescence in situ hybridisation.
6616621 1983 Structure and activation of the human N-ras gene.
6587382 1984 Mechanism of activation of an N-ras oncogene of SW-1271 human lung carcinoma cells.
6086315 1984 Mechanism of activation of an N-ras gene in the human fibrosarcoma cell line HT1080.
3887133 1985 Activation of N-ras in a human melanoma cell line.
3856237 1985 Activation of an N-ras gene in acute myeloblastic leukemia through somatic mutation in the first exon.
3295562 1987 A point mutation at codon 13 of the N-ras oncogene in myelodysplastic syndrome.
3276402 1988 Detection of a low frequency of activated ras genes in human melanomas using a tumorigenicity assay.
3102434 1987 Amino-acid substitution at codon 13 of the N-ras oncogene in rectal cancer in a Japanese patient.
3057505 1988 Analysis of RAS oncogene mutations in human lymphoid malignancies.
2998510 1985 Transforming genes in human leukemia cells.
2991860 1985 Human N-ras: cDNA cloning and gene structure.
2661017 1989 All ras proteins are polyisoprenylated but only some are palmitoylated.
1970154 1990 Transforming genes from familial adenomatous polyposis patient cells detected by a tumorigenicity assay.
1692298 1990 Mapping the human amylase gene cluster on the proximal short arm of chromosome 1 using a highly informative (CA)n repeat.