Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.92
PubTator Score 3.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Brain Neoplasms 33 0.0 0.0
Disease Target Count P-value
ulcerative colitis 1819 4.1e-04
osteosarcoma 7950 1.0e-02
ependymoma 4679 2.3e-02
spina bifida 1074 4.9e-02
Disease Target Count Z-score Confidence
Inflammatory Breast Carcinoma 2 3.822 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.500 2.3e-02
osteosarcoma -1.118 1.0e-02
spina bifida -2.062 4.9e-02
ulcerative colitis -1.200 4.1e-04

Gene RIF (3)

AA Sequence

MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLL      1 - 70
VKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR                               71 - 114
//

Text Mined References (12)

PMID Year Title