Property Summary

NCBI Gene PubMed Count 75
PubMed Score 112.68
PubTator Score 205.67

Knowledge Summary

Patent (152,037)

TINX Plot

  Disease (7)

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -2.333 6.7e-04
Breast cancer -2.300 8.9e-68
chronic rhinosinusitis -1.254 1.4e-02
cutaneous lupus erythematosus 2.100 5.6e-03
gastric cancer -1.100 3.1e-02
Gaucher disease type 1 -1.500 3.7e-02
glioblastoma -1.200 6.0e-03
interstitial cystitis 1.200 8.8e-03
intraductal papillary-mucinous carcinoma... -1.400 4.5e-02
intraductal papillary-mucinous neoplasm ... -1.300 3.4e-02
lung adenocarcinoma -1.888 1.1e-08
lung cancer -3.200 3.3e-06
medulloblastoma -1.100 1.8e-02
non-small cell lung cancer -1.767 4.5e-09
osteosarcoma 1.106 3.7e-02
pediatric high grade glioma -1.200 2.9e-02
pituitary cancer -1.900 4.0e-03
psoriasis 2.300 2.2e-81
tuberculosis -3.600 3.4e-06
ulcerative colitis 1.500 1.3e-03

 GWAS Trait (1)

Gene RIF (64)

AA Sequence

MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSISTFVEGYSSNYE      1 - 70
LKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLPSTSMYFKQSPP     71 - 140
STPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPHPPAPSPAGGHH    141 - 210
LGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSP    211 - 280
PSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ    281 - 350
KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC    351 - 420
PTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAE    421 - 490
DKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCN    491 - 560
KITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF        561 - 626
//

Text Mined References (75)

PMID Year Title