Property Summary

NCBI Gene PubMed Count 191
PubMed Score 811.96
PubTator Score 2018.75

Knowledge Summary

Patent (67,519)


  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -2.177 2.2e-05
atypical teratoid/rhabdoid tumor -1.300 2.3e-04
Bipolar Disorder 1.486 3.9e-02
Breast cancer -1.200 2.5e-10
chronic rhinosinusitis -1.380 2.4e-02
cystic fibrosis 1.100 1.6e-03
Duchenne muscular dystrophy -1.000 2.5e-05
gastric cancer -1.400 1.8e-03
group 4 medulloblastoma -1.600 2.2e-03
hepatocellular carcinoma -1.200 1.5e-05
lung adenocarcinoma -1.300 8.3e-03
lung cancer -1.500 1.7e-04
non-small cell lung cancer -2.091 1.1e-16
osteosarcoma 1.563 7.5e-03
pancreatic cancer -1.500 1.5e-03
pancreatic carcinoma -1.500 1.5e-03
pediatric high grade glioma -1.100 4.0e-03
pituitary cancer -3.000 1.1e-06
primary pancreatic ductal adenocarcinoma 1.106 4.2e-02
psoriasis 1.600 2.1e-04

Protein-protein Interaction (4)

PDB (15)

Gene RIF (167)

AA Sequence

ELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF                                    561 - 598

Text Mined References (195)

PMID Year Title