Property Summary

NCBI Gene PubMed Count 842
PubMed Score 2131.29
PubTator Score 3774.46

Knowledge Summary

Patent (124,718)

TINX Plot

  Disease (7)

Disease Target Count
Asthma 349
Acne vulgaris 16
Acquired thrombocytopenia 7
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 7
Adrenogenital disorder 6
Allergic Rhinitis Prevention 1
Allergic asthma 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 25
Allergic otitis externa 1
Allergic rhinitis 92
Alopecia areata 37
Angioedema 36
Ankylosing spondylitis 138
Anterior uveitis 3
Aphthous ulcer of mouth 7
Articular gout 11
Aspiration pneumonitis 6
Asthma management 20
Atopic dermatitis 944
Autoimmune disease 5
Autoimmune hemolytic anemia 17
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 28
Blepharoconjunctivitis 5
Branch retinal vein occlusion with macular edema 4
Bronchospasm Prevention with COPD 3
Burkitt's lymphoma 15
Bursitis 10
COPD Associated with Chronic Bronchitis 11
Candidiasis of skin 6
Central retinal vein occlusion with macular edema 4
Cerebral edema 5
Chloasma 5
Choroiditis 5
Chronic Non-Allergic Rhinitis 1
Chronic lymphoid leukemia, disease 10
Chronic ulcerative proctitis 7
Congenital adrenal hyperplasia 74
Congenital hypoplastic anemia 8
Contact Dermatitis 80
Corneal abrasion 6
Corneal ulcer 9
Crohn's disease 304
Crohn's disease in remission 1
Cyclitis 6
Cystic Aponeurosis Tumor 1
Dacryocystitis 7
Dermatitis herpetiformis 11
Dermatosis of scalp 1
Diagnostic Test for Cushing's Syndrome 5
Diffuse Proliferative Lupus Nephritis 1
Diffuse non-Hodgkin's lymphoma, large cell 12
Discoid lupus erythematosus 7
Disorder of eye 7
Disorder of musculoskeletal system 5
Disorder of skin 5
Eczema 3
Edema of larynx 5
Eosinophilic asthma 5
Epicondylitis 19
Eruption of skin 5
Erythema multiforme 15
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Exfoliative Erythroderma 1
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 5
Gingival Disorders 3
Granuloma annulare 5
Hemorrhoids 13
Herpes zoster keratitis 6
Herpes zoster keratoconjunctivitis 1
Hodgkin's disease 18
Humoral hypercalcemia of malignancy 6
Idiopathic thrombocytopenic purpura 5
Infection by larvae of Trichinella spiralis 3
Infective blepharitis 5
Infective otitis externa 4
Infective otitis media 3
Inflammatory bowel disease 142
Inflammatory dermatosis 38
Iridocyclitis 12
Iritis 9
Itching of ear 3
Juvenile rheumatoid arthritis 105
Keloid scar 1
Keratitis 42
Lichen planus 17
Lichen simplex chronicus 7
Löffler's syndrome 5
Malignant otitis externa due to Pseudomonas aeruginosa 4
Mastoidectomy Cavity Infections 3
Meibomianitis 4
Miliary tuberculosis 5
Minor Bacterial Skin Infections 3
Multiple Sclerosis 498
Multiple myeloma 1327
Mycosis fungoides 30
Nasal polyp 2
Necrobiosis lipoidica diabeticorum 1
Nephrotic Syndrome 48
Non-Hodgkin's lymphoma 22
Non-allergic asthma 5
Non-infectious Posterior Uveitis 1
Nummular eczema 1
Ocular rosacea 4
Otitis Externa Eczema 1
Otitis Externa Seborrhea 1
Otitis externa 9
Pemphigus 18
Perennial allergic rhinitis 2
Perforation of cornea 1
Pityriasis simplex 6
Plaque psoriasis 14
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 10
Postoperative Ocular Pain 5
Pregnancy with abortive outcome 12
Prevention of Transplant Rejection 6
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Proctitis 11
Progressive Diffuse Large B-Cell Lymphoma 4
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Pulmonary emphysema 34
Punctate Epithelial Keratopathy 6
Punctate keratitis 1
Punctate keratopathy 3
Recurrent herpes simplex labialis 3
Rheumatic heart disease 8
Rheumatoid Arthritis 1170
Rhinitis 46
Rosacea 18
Scalp psoriasis 6
Seasonal allergic rhinitis 10
Seborrheic dermatitis 19
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Staphylococcus Aureus Otitis Externa 4
Stevens-Johnson syndrome 91
Subacute bursitis 1
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 72
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Tendinitis 13
Tenosynovitis 15
Thyroiditis 25
Tinea corporis 25
Tinea cruris 12
Tinea pedis 30
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Tuberculosis Meningitis Treatment Adjunct 1
Uveitis 103
Vasomotor rhinitis 15
Vitrectomy Adjunct to Enhance Visualization 1
psoriasis 6685
sarcoidosis 368
systemic lupus erythematosus 172
ulcerative colitis 2087
Disease Target Count Z-score Confidence
Pseudohermaphroditism 16 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.274 8.4e-03
psoriasis -1.100 1.7e-06
osteosarcoma 1.902 1.0e-04
group 4 medulloblastoma -2.400 3.0e-05
atypical teratoid / rhabdoid tumor -1.800 1.3e-03
medulloblastoma, large-cell -2.200 1.3e-03
primitive neuroectodermal tumor -1.400 4.4e-02
tuberculosis -1.700 2.0e-07
intraductal papillary-mucinous carcinoma... -2.700 1.8e-02
lung cancer -2.500 6.2e-06
active ulcerative colitis -1.267 3.3e-02
breast carcinoma -1.800 1.3e-38
Breast cancer -2.000 3.1e-10
ductal carcinoma in situ -1.700 1.0e-04
invasive ductal carcinoma -2.300 9.4e-05
ovarian cancer -2.300 2.4e-05

Synonym

Accession P04150 A0ZXF9 B0LPG8 D3DQF4 F5ATB7 P04151 Q53EP5 Q6N0A4 GR
Symbols GR
GCR
GRL
GCCR
GCRST

Gene

PDB

3H52   4MDD   1M2Z   1P93   3CLD   3E7C   3K22   3K23   4CSJ   4P6W   4P6X   4UDC   4UDD   1NHZ   3BQD   4HN5   4HN6   4LSJ   5CBX   5CBY   5CBZ   5CC1   5EMC   5EMP   5EMQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Jun Qin 39 Signaling network evaluation of transcript factor crosstalk via catTRE/MS

Protein-protein Interaction (5)

MLP Assay (18)

AID Type Active / Inconclusive / Inactive Description
450 confirmatory 118 / 160 / 10671 GR-GFP Redistribution
451 confirmatory 40 / 101 / 8587 GR-EFC Redistribution
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
More...

Gene RIF (731)

PMID Text
26938822 The NR3C1 gene is associated with anorexia nervosa risk regardless of the type of stressful triggering factors in polish adolescent girls.
26907965 Roles of individual amino acids in human mineralocorticoid and glucocorticoid receptors in the transactivation of downstream genes in response to cortisol and aldosterone.
26821164 This study found sex-specific NR3C1 associations with the muscle strength and size response to resistance training.
26782558 Higher levels of methylation at the NR3C1 promoter may be associated with major depressive disorder in a gender-specific manner.
26745667 The results reveal molecular defects of pathologic mutant receptors and provide important insights to the actions of wild-type GR.
26711253 Human GR beta regulates unique components of liver gene expression in vivo by both GR alpha-dependent and GR alpha-independent mechanisms.
26647360 Epigenetic modifications of the glucocorticoid receptor gene (NR3C1) have been associated with early-life experiences.
26635083 Activation of the H1R by its full agonists resulted in a composite potentiating effect. Intriguingly, inactivation of the Gaq-PLC pathway by H1R inverse agonists resulted also in a potentiation of GR activity.
26585459 Infants with the high-risk neurobehavioral profile showed more methylation than infants with the low-risk neurobehavioral profile at CpG3 for NR3C1 and less methylation of CpG3 for HSD11B2.
26541474 The hGRalphaT556I causes Chrousos syndrome by impairing multiple steps of the glucocorticoid signal transduction pathway.
26480216 Glucocorticoid receptor-beta regulated the expression of numerous genes involved in intact intestinal barrier function.
26408078 This is the first report of genome-wide GR ChIP-seq and gene expression analysis in human fat. The results implicate regulation of key GR target genes that are involved in dampening inflammation and promoting cellular metabolism.
26387521 relationship between depression, early trauma, the HPA axis and the DNA methylation status of the NR3C1 gene [review]
26343289 Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated.
26327302 This result supports the proposed association between a specific CpG site located at the NR3C1 promoter and prenatal stress.
26270571 Demonstrate existence of a novel mechanism of GC insensitivity in asthmatics resulting from limited GR nuclear bioavailability as a consequence of decreased baseline GR protein expression and more rapid hormone-induced downregulation.
26267475 A minimal kinetic model consistent with the data is that in which DNA-bound GR interconverts between states on a second time scale, with dissociation occurring via a multistep process.
26242202 human endothelial glucocorticoid receptor 5'UTR mRNA expression is regulated by promoter methylation with dexamethasone-sensitive and dexamethasone-resistant cells having different glucocorticoid receptor promoter methylation patterns.
26230484 No evidence of an additional effect of childhood trauma on CFS via alterations in NR3C1 methylation.
26228405 This study demostrated that in crack/cocaine addiction involving an interaction between NR3C2 and NR3C1 genes.
26186654 In monozygotic twins, methylation variation in NR3C1 exon 1F promoter significantly influences subclinical atherosclerosis, independent of genetic, early family environmental and other risk factors.
26183204 Results suggest that (enhanced green fluorescence protein) EGFP-(glucocorticoid receptor) GR forms not only a monomer-dimer equivalent state but also a large-molecular-weight complex.
26152664 Increased epigenetic methylation of NR3C1 promoter 1F CpG sites is associated with both higher circulating cortisol levels and increased vulnerability to behavior disorders in young children.
26139210 The BclI polymorphism of the GR gene may contribute to an unfavorable cardiovascular profile; however, the effects on cardiovascular variables appear to be limited and partly mediated by the metabolic phenotype exerted by BclI.
26118026 NR3C1 polymorphism is a risk factor for the development of bronchial asthma and chronic obstructive pulmonary disease, as well as the aggravating factor in the progression of cystic fibrosis. (Review)
26088140 GR and KLF15 physically interact via low affinity GR binding sites within glucocorticoid response elements (GREs) for PRODH and AASS that contribute to combinatorial regulation with KLF15.
26080088 The interaction between childhood maltreatment and GR methylation to be strongly correlated with an increased vulnerability to psychopathology providing evidence of epigenome x environment interactions.
26055322 The transient appearance of glucocorticoid receptor (GR)/BRG1-dependent, TOP2beta -mediated double-strand DNA breaks is required for efficient GR-stimulated transcription.
26032496 Kaposi's sarcoma-associated herpesvirus - encoded LANA enhances glucocorticoid receptor activation and cell growth suppression in human B-lymphocytes.
25970251 activation of the peroxisome proliferator-activated receptor alpha (PPAR-alpha) by the PPAR-alpha agonists GW7647 and fenofibrate synergizes with the glucocorticoid receptor (GR) to promote BFU-E self-renewal
25953903 The contrastingly reduced conformational plasticity of the corresponding FK1 domain of FKBP52 is consistent with the current model in which FKBP51 binds to both the apo- and hormone-bound forms of the steroid receptor
25951242 These results suggest that methylation of NR3C1 may impair negative feedback of the HPA-axis in adolescents.
25942041 NR3C1 1-F promoter methylation in infants is elevated in the presence of increased maternal postnatal depression following low prenatal depression, and this effect is reversed by stroking of the infants by their mothers over the first weeks of life.
25938942 The NLRP3-CASP1 inflammasome modulates cellular levels of the glucocorticoid receptor and diminishes cell sensitivity to glucocorticoids.
25926062 The glucocorticoid receptor A3669G SNP is not associated with polycythemia vera, essential thrombocythemia or primary myelofibrosis
25899090 NR3C1 mRNA expression was significantly lower in patients with SLE compared to controls. NR3C1 promoters were more methylated in SLE patients than controls.
25889020 findings suggest that gene methylation, particularly of NR3C1, may be involved in the development of internalizing problems in adolescence.
25879559 Thus, G/G genotype of Bcl1 polymorphism of the glucocorticoid receptor gene is associated with the development of asthma.
25875334 The study highlights the susceptibility of males to changes in NR3C1 DNA methylation and present novel evidence for altered BDNF IV DNA methylation in response to maternal depression during pregnancy.
25847991 an unexpected role for the GR in promoting accurate chromosome segregation during mitosis, which is causally linked to tumorigenesis, making GR an authentic tumor suppressor gene.
25815773 This study suggests that the D641V variant of the GR is probably associated with SR asthma in the Chinese Han population.
25775514 GR and PNRC2 interact in a ligand-dependent manner to recruit UPF1 for rapid mRNA degradation
25772595 MiR-9 regulates GR signaling and steroid-resistant airway hyperresponsiveness by reducing protein phosphatase 2A activity.
25771224 Glucocorticoid receptor NR3C1 variant 1 contains a functionally relevant upstream open reading frame due to single nucleotide polymorphism in the 5'UTR.
25765757 There were no consistent associations between GR and MR gene polymorphisms, interactions between GR and MR haplotypes and stressful conditions and recurrence of major depressive disorder.
25762479 GR expression is associated with features of good outcome but does not provide prognostic information independent of size, stage and grade.
25748343 Glucocorticoid receptor cysteine oxidation impairs systemic glucocorticoid responsiveness in children with difficult-to-treat asthma.
25745955 GR was not differentially expressed in PTSD patients with low HPA axis reactivity compared to PTSD patients with high HPA axis reactivity.
25724472 Carriers of the BclI-G and N363S-G alleles had lower levels of baseline rheumatoid arthritis disease activity, suggesting a role for the GR gene in regulation of glucocorticoid sensitivity to endogenously produced cortisol.
25687413 The hypothalamus-pituitary-adrenal axis is sensitive to changes in the early-life environment that associate with DNA methylation of a neuron-specific exon 17 promoter of the glucocorticoid receptor (GR) (Nr3c1). [review]
25665148 Data demonstrate that the decreased expression of GRalpha might be the evidence of high disease activity and help to predict glucorticoid resistance in systemic lupus erythematosus.
25649164 The SNPs of NR3C1 gene play a role in the regulatory function in the bronchi of patients with asthma.
25644744 Our results suggested that polymorphisms in the non-coding region of the GR gene were associated with prednisone response in vivo in pediatric acute lymphoblastic leukemia in Han Chinese.
25640832 In the analyses reported in this article, we test the hypothesis that the G x I between NR3C1 SNP rs10482672 and Fast Track treatment operates via changes to children's behavior in childhood and adolescence.
25601472 Subjects being poor responders to GCs presented higher levels of GAS5 and NR3C1 in comparison with good responders
25518867 Significantly higher levels of plasma cortisol and GRbeta/GRalpha mRNA ratio were observed among the employees with suboptimal health status with psychosocial stress.
25511704 GR tau1c phosphorylation could promote CBP recruitment and enhance activation function 1 activity.
25479081 A set of 82 infection and exposure-related genes was identified and found to be enriched for their role in the glucocorticoid receptor signal transduction pathway.
25459891 infants with low NR3C1 methylation but high HSD11B2 methylation had lower excitability scores; those with high NR3C1 methylation but low HSD11B2 methylation had more asymmetrical reflexes
25422592 gene-specific selectivity patterns of four glucocorticoid receptor coregulators
25301232 GRbeta bound to the N-terminus domain of TCF-4 its influence on Wnt signaling required both ligand- and DNA-binding domains. This is enough to maintain the TCF/LEF activity at a high level in the absence of beta-catenin stabilization.
25202013 Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner
25155432 Mutations in glucocorticoid receptor is associated with tissue sensitivity to glucocorticoids.
25150144 The role of the alternative first exons and their associated 5'UTRs has now been expanded to translational control, influencing total GR levels, individual constituent isoform levels, as well as trafficking to the cell surface.
25138562 Glucocorticoid receptor expression is negatively regulated by androgen receptor (AR) signaling and may serve as a marker for AR signaling in prostate tumors.
25113244 these data support the notion that stressful life events, the number of trauma events, and social support may play a contributing role in the risk for post-traumatic stress disorder by interacting with GR gene polymorphisms.
25104270 Polymorphism of NR3C1 gene is associated with metabolic syndrome and may contribute to the susceptibility of metabolic syndrome.
25080589 The findings of this study indicated that an epigenetic modification of the glucocorticoid receptor gene promoter is linked to interindividual and gender-specific differences in memory functions and PTSD risk.
25058354 study identifies a positive ultra-short regulatory loop exerted by GR on steroidogenesis in H295R cells, thus supporting a complex intra-adrenal GR-mediated feedback, likely relevant for human adrenocortical pathologies.
25048180 The results indicated a significant positive correlation between NR3C1 methylation status and childhood maltreatment (specifically physical abuse).
25043756 Castration-resistant prostate cancer cell activation is induced regardless of presence of AR; in cells devoid of AR, glucocorticoid receptor GR interacts directly with p-STAT5.
25023132 our data show that the postnatal environment influences epigenetic programming of glucocorticoid receptor expression through methylation of the glucocorticoid receptor gene promoter in premature infants
25015855 glucocorticoid receptor expression was downregulated in bladder tumors compared with nonneoplastic bladder tumors
24949977 Study reveals that Hsp70, known to facilitate client delivery to Hsp90, inactivates GR through partial unfolding, whereas Hsp90 reverses this inactivation. Full recovery of ligand binding requires ATP hydrolysis on Hsp90 and the Hop and p23 cochaperones.
24946471 ER22/23EK functional polymorphism of the glucocorticoid receptor gene is not associated with unipolar and bipolar disorder
24915124 Polymorphisms in the 11betaHSD1 and NR3C1 genes were associated with impaired cognitive function in Cushings syndrome.
24895125 TBL1XR1 knockdown results in reduced glucocorticoid receptor recruitment to glucocorticoid responsive genes and ultimately decreased glucocorticoid signaling
24832930 first study to demonstrate alterations of GR-1F promoter methylation in relation to parental PTSD and neuroendocrine outcomes.
24816241 Children with glucocorticoid receptor polymorphisms ER22/23EK and BcII were more susceptible to adrenal insufficiency during treatment for acute lymphoblastic leukemia.
24741566 The analysed candidate haplotypes in FKBP5, NR3C1, and CRHR1 did not show an association with depression scores as assessed by EPDS in this cohort of healthy unselected pregnant women.
24736075 Low glucocorticoid receptor alpha expression is associated with low response to pemetrexed in non-small-cell lung cancer.
24728165 BclI polymorphism was associated with altered glucocorticoid sensitivity in the hypothalamus-pituitary-adrenal axis, but not in mononuclear cell proliferation, suggesting a tissue-specific influence of BclI SNP.
24702814 Its signaling is inactivated by amyloid beta protein, which has important implications for the pathogenic mechanism of Alzheimer disease.
24661442 Alterations in NR3C1-1F promoter methylation may reflect enduring changes resulting from combat exposure that lead to functional neuroendocrine alterations.
24629067 Results suggest that GR may be a potential target for BRCA1 in ovarian cancer progression.
24626943 The BclI variant of the NR3C1 gene is associated with a lower frequency of insulin resistance in women with polycystic ovary syndrome.
24622770 Hypermethylation of the promoter in tumors is a frequent event and suggests that Glucocorticoid Receptor may act as a tumor suppressor in breast tissue.
24615402 Data indicate that glucocorticoid receptor (GR) expression increases in prostate cancer following androgen receptor (AR)-inhibition.
24602212 There is lack of association between NR3C1 polymorphisms and erythropoiesis.
24559102 The site of action for several cofactors of glucocorticoid receptor (GR) transactivation is identified.
24535466 Analysis of BCL1 and N363S polymorphisms of the glucocorticoid receptor gene in metabolically obese normal-weight women shows similar distribution of polymorphisms compared to control group.
24515279 Together, these results suggest that GR modulates involucrin expression of keratinocytes by regulating the intracellular signaling network in a ligand-independent manner.
24500711 A novel intronic enhancer for TNFAIP3 was synergistically induced by the glucocorticoid receptor and NF-kappaB.
24483153 The natural mutant receptor hGRalphaV575G causes primary generalized glucocorticoid resistance by affecting multiple steps in the glucocorticoid signaling cascade.
24466047 Associations between the 9beta glucocorticoid receptor polymorphism and cardiovascular risk factors or hydrocortisone dose.
24465557 Lower methylation in the NR3C1 promoter, which might have compensatory effects relating to CA2-3 and CA4-dentate gyrus, is a distinct epigenetic characteristic in non-psychotic outpatients with major depressive disorder.
24429396 Report an association between the GR-9b haplotype of the glucocorticoid receptor gene and unfavorable clinical outcome in children with nephrotic syndrome.
24422633 Extrinsic recruitment of a strong transactivation function can enhance the efficacy of the glucocorticoid receptor agonist dexamethasone and reverse the antagonist character of RU-486 at an endogenous locus.
24418810 Results are suggestive that the new Tth111 haplotype of the GR gene may be associated with a healthier metabolic profile in African-Americans with HIV infection.
24418538 Over-expression of the RSV NS1 impairs glucocorticoid receptor-induced transactivation.
24417561 This study does not confirm a role for genetic variants in the MYOC, NR3C1 and FKBP5 genes in the pathogenesis of corticosteroid-induced ocular hypertension.
24399729 Glucocorticoid receptor-induced expression of HNF4alpha may contribute to indirect OCT1 gene up-regulation by dexamethasone in primary human hepatocytes.
24316275 Each tested drugs were determined and compared in AhR-, GR- and PXR-gene reporter cell lines.
24186266 Exposure to follicular fluid transiently increased the transcript levels of IL8 and PTGS2, and decreased the expression of SOD2, GPX3, DAB2, and NR3C1. TNF and IL6 levels were also decreased while those of NAMPT were unaffected.
24166279 BRCA1 regulates glucocorticoid receptor expression and activity.Loss of glucocorticoid receptor activation is a hallmark of BRCA1-mutated breast tissue.
24128430 genetic association study in population in Italy: Data suggest no association exists between 3 polymorphisms in GR/NR3C1 studied (ER22/23EK; N363S; BCL1) with therapeutic response/side effects in Graves ophthalmopathy treated with methylprednisolone.
24097989 These studies allow us to position the actions of two new modulators of GR-regulated transactivation, NELF-A and NELF-B, relative to other factors in the overall gene induction sequence.
24012103 For NR3C1 gene polymorphisms we have not detected any associations with affective or bipolar disorders
23986795 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
23979790 The aim of the work was to investigate the expression of HSD11B1, HSD11B2, H6PDH, and glucocorticoids receptor (GR) mRNA in subcutaneous adipose tissue (SAT) from obese women with or without polycystic ovary syndrome.
23963647 Treatment with either RU486 or GR siRNA significantly increased the proliferation of bone marrow mesenchymal stromal cells and their osteogenic capabilities, as reflected by an increase in alkaline phosphatase (ALP) levels after differentiation.
23892712 Polymorphism of the Glucocorticoid receptor gene was associated with cardiovascular risk factors and may contribute to susceptibility to cardiovascular disease in the Chinese Han population.
23892638 A case-control study of Chinese railroad workers determined the interaction between the GRBCL1 gene was statistically significant for occupational stress increasing the risk for essential hypertension.
23845513 results suggested that the observed dysregulation of the HPA axis in suicide may be related to a decreased expression of GR-a and GR inducible genes in the PFC and amygdala of teenage suicide victims.
23820903 These studies, together with the observations that GR isoforms have cell-specific expression patterns, provide a molecular basis for the tissue-specific functions of GR translational isoforms.
23814048 The recruitment of GR to ERalpha-binding regions (EBRs) requires assistance from ERalpha and FOXA1 and is facilitated by AP1 binding within the EBRs.
23778418 this study demonstrates an association between the BclI polymorphism (NR3CI) and increased BMI values in Cushing's disease patients.
23759144 There is a transient increased expression of glucocorticoid receptor beta in mononuclear cells from septic patients.
23658782 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
23623868 The glucocorticoid receptor repress genes encoding cytokines, chemokines and other pro-inflammatory mediators. [Review]
23603102 roles of glucocorticoids and their receptors in mitochondria
23566423 These data indicate that prenatal maternal emotional state, particularly pregnancy related anxiety, are associated with the methylation state of the NR3C1 gene in the child.
23548248 total and cytoplasmic, but not nuclear GR levels were significantly lower in PBMCs from critically ill children (i.e. sepsis/septic shock and traumatic brain injury) compared to healthy controls
23543128 These findings are consistent with a possible link between NR3C2 and NR3C1 polymorphisms and smoking behavior
23527567 Lack of association between NR3C1 polymorphism and glucocorticoid resistance in Chinese patients with immune thrombocytopenia.
23523565 Glucocorticoid receptor primary target genes confer the metabolic functions of the glucocorticoids. [Review]
23506845 Decreased PGDH expression is associated with increased GR and PRA, although decreased PRB, in chorion during labor.
23499945 Glucocorticoid receptor recruitment and its modulation of gene expression. [Review]
23449091 Childhood-adversity subtypes may differentially impact DNA methylation at NR3C1
23440419 DC-SCRIPT serves an important role in regulating GR function in DCs, corepressing GR-dependent upregulation of the tolerance-inducing transcription factor GILZ.
23435844 mRNA expression of GRalpha, GRbeta, GRgamma, & GRp was measured in peripheral blood mononuclear cells from immune thrombocytopenia patients.GRalpha mRNA & GRalpha protein were significantly higher in glucocorticoid-sensitive patients.
23428870 Time course studies following glucocorticoid treatment revealed a rapid decrease in nascent glucocorticoid receptor RNA in human, mouse, and rat cell lines as well as in various mouse tissues.
23426617 The natural mutant receptor hGRalphaV423A causes primary generalized glucocorticoid resistance by affecting multiple steps in the cascade of glucocorticoid receptor action.
23393177 Homozygous carriers of the BclI polymorphism of the GR gene have significantly greater total body fatness, contributing to higher insulin resistance, compared with heterozygous carriers and noncarriers.
23392094 Current understanding of the mechanisms that modulate glucocorticoid sensitivity and resistance with a focus on GR-mediated signaling.[review]
23391271 The impaired DNA-binding of the human glucocorticoid receptor, R477H mutant, may explain the severe phenotype of cortisol resistance seen with this mutation.
23355259 study found patients with the N363S polymorphism in the glucocorticoid receptor are more prone to steroid-related toxicity during acute lymphoid leukemia therapy
23334186 Impaired nuclear translocation of glucocorticoid receptors in psoriasis.
23329746 in preterm infants, both the expression of GRbeta and the GRalpha/GRbeta ratio were associated with birth weight.
23325854 The glucocorticoid receptor is a novel trans-acting factor that regulates CFTR expression in vivo.
23307810 Data indicate that glucocorticoid receptor (GR) integrates multiple signals to give rise to many distinct patterns of expression.
23297131 Glucocorticoids may spare immature dendritic cells (DCs) and suppress mature DCs and inflammation via differential expression of GR translational isoforms.
23290588 Glucocorticoid receptor is prominently expressed in human hippocampus and remains stable in the aging brain.
23267834 Glucocorticoid receptors modulate the activity of immune-regulating transcription factors. [Review]
23239757 genetic association studies in population in South Africa: Data suggest that genetic polymorphisms in NR3C1 are associated with hyperlipidemias, overweight, and drug resistance to glucocorticoid replacement in patients with Addison's disease.
23239753 results suggest that constitutive activation of the noncanonical NF-kappaB pathway in term placenta is driven by the glucocorticoid receptor signaling, which in turn up-regulates placental corticotropin-releasing hormone and other NF-kappaB-responsive genes
23228967 defines GRalpha as a novel FBXW7 substrate
23222642 findings show negative glucocorticoid response element(nGRE) binding is a new mode of sequence recognition by GR and that nGREs prevent receptor dimerization through a unique GR-binding orientation and strong negative cooperativity, ensuring presence of monomeric GR at repressive elements
23219223 results reveal that FKBP5 and GR gene expression were significantly reduced in the AMY of suicide victims compared with controls.
23212335 Epicardial adipose tissue has lower GRalphamRNA levels in insulin-resistant patients; this seems to be an adaptive and protective mechanism.
23209664 progesterone acts via GR to repress IL-1beta-driven COX-2 activation; p65 and PRB may have roles in the repression of progesterone driven gene expression, but not necessarily in progesterone repression of IL-1beta-induced COX-2 expression
23204024 SNPs in NR3C2 or NR3C1 are not associated with asthma development
23196783 GR gene variants, C allele of Bcl I and minor allele of 9beta, are associated with adrenal incidentalomas.
23178279 The reduction in the observed rate of nuclear import and increased rate of nuclear export displayed at low GR concentrations and by the GR dimerization could explain the lowered glucocorticoid response under these conditions.
23176645 The BclI polymorphism of Glucocorticoid receptor identifies different immunomodulatory responses to corticosteroids, which may explain, at least in part, the variability in individual sensitivity to stressors.
23151527 Tth111I NR3C1 polymorphism may play a protective role in the development of coronary artery disease, and homozygous TT in development of multivessel disease; the N363S polymorphisms may contribute to the development of diabetes in the Polish population
23148886 These findings suggest that the Bcll polymorphism of the glucocorticoid receptor contributes to inter-individual differences in emotional memory in healthy humans.
23137715 A selective disturbance of MR and of the GRalpha/MR ratio thus seems to exist in the ACC/DLPFC in depression, which was inversely correlated with the corresponding levels in the PVN.
23132854 Binding of the N-terminal region of TIF2 to the AF1 domain of the glucocorticoid receptor changes both its conformation and transcriptional activity.
23127816 The versatility of the glucocorticoid receptor in forming homodimer interactions, as well as the ability to bind to alternate nuclear receptors. [Review]
23125313 GR and p300 are involved in the induction of H6PD by cortisol in human amnion fibroblasts
23124618 A significant relationship was found between the expression of CysLT1 receptor and GR-beta in nasal polyps (R = .525, P = .04), whereas there was no significant relationship between the expression of CysLT1 receptor and GR-alpha in nasal polyps.
23123359 altered phosphorylation of GR could contribute to impaired GR function related to the pathophysiology of depression.
23073785 Genetic variants of the NR3C1 gene are associated with recurrent depressive disorder and may be associated with the etiology of the disease.
23072594 These results suggest the presence in melanoma of growth mechanisms involving nestin, vimentin, and the glucocorticoid receptor may help in understanding tumour biology to provide a molecular basis for clinical therapies.
23068076 The results of thi study showed that no association was found for alleles, genotypes, or haplotype analysis for NR3C1 genes and melancholic depression.
23055525 SMRT and GR act in a consistent manner with steroid hormones
23055001 A specific haplotype (G:A:G:G; ER22/23EK- N363S- BclI- A3669G) of NR3C1 showed a significant association with behaviors related to ADHD and with response to methylprhenidate.
23046934 The increased expressions of OB-R, IRF-1 and GR-beta in airway smooth muscle cells (ASMCs) of obese rats with asthma may play a role in the onset of obese asthma and glucocorticoid resistance.
23033539 Studies indicate that the molecular basis of primary generalized glucocorticoid resistance (PGGR or Chrousos syndrome) and primary generalized glucocorticoid hypersensitivity (PGGH) has been ascribed to mutations in glucocorticoid receptor (hGR).
23033538 Data indicate that Clock-Bmal1 regulates the response to glucocorticoids in peripheral tissues through acetylation of the glucocorticoid receptor (GR), possibly antagonizing the biologic actions of diurnally fluctuating circulating cortisol.
23028665 the association between the NR3C1 polymorphisms and the metabolic profile of congenital adrenal hyperplasia patients
22922069 Data suggest that NR3C1 is down-regulated in placenta/cytotrophoblasts in response to spontaneous syncytialization or glucocorticoids; in contrast, ABC drug transporters are up-regulated under these influences.
22889053 Glucocorticoid receptor gene polymorphisms were associated with level of disease activity of rheumatoid arthritis in the postpartum period.
22879541 A3669G polymorphism of glucocorticoid receptor is a susceptibility allele for primary myelofibrosis and contributes to phenotypic diversity and blast transformation.
22855579 The identification of an interaction term between thalidomide and NR3C1 underscores the importance of pharmacogenomic studies in the systematic study of new drugs.
22851186 Data suggest that high risk health conditions, such as obesity and type-2 diabetes, are associated with a form of hypothalamic-pituitary-adrenal axis dysfunction, characterized by localized leukocyte glucocorticoid receptor over-expression.
22848740 catabolic glucocorticoid hormones and high intracellular AMP levels cooperate in inducing FOXO3 transcription and in activating the corresponding protein
22846929 Down-regulation of NR3C1 are associated with Glucocorticoid resistance of T-cell lymphoblastic leukemia/lymphoma.
22832351 Childhood sexual abuse, its severity and the number of maltreatment types positively correlate with NR3C1 promoter methylation in adults with borderline personality disorder and major depressive disorder.
22812453 Our results suggest that the GRalpha-D1 protein isoform may be up-regulated widely across the frontal cortex in psychiatric illness.
22810058 Culturally relevant measures of maternal prenatal stress significantly correlates with newborn birth weight and newborn methylation in the NR3C1 promoter.
22801563 Black Mississippians have a higher BMI than whites, which may be related to the presence of the BclI polymorphism and increased glucocorticoid sensitivity
22798432 glucocorticoid receptor and HDAC2 are recruited to the MUC5AC promoter and mediate the glucocorticoid repression of MUC5AC gene expression.
22781842 This study found that variation in GR at rs41423247 moderates the effect of prenatal maternal psychological symptoms on child emotional and behavioral problems.
22773829 activated GR can inhibit p53-dependent apoptosis through induction of the anti-apoptotic factor PKCepsilon.
22771494 The results indicate that GSK3beta is important for GR transactivation activity and that GSK3beta inhibition suppresses GC-stimulated gene expression.
22728713 importance of the NR3C1 gene polymorphism for genetic susceptibility to infantile spasms in a Chinese population
22714792 Placental NR3C1 methylation is associated with infant quality of movement and with infant attention, and there is a potential interaction between methylation and genotype on infant attention score.
22698871 despite the complexity of glucocorticoid receptor function, DNA binding energetics are the primary determinant of sequence-specific transcriptional activity.
22592921 proasthmatic cytokine-induced corticosteroid insensitivity in airway smooth muscle cells is due, in part, to PP5-mediated impairment of glucocorticoid receptor-Ser211 phosphorylation.
22587831 results suggest that glucocorticoid receptor gene BclI polymorphism may influence the sensitivity to glucocorticoids in patients with Addison's disease and may contribute to the increase in central adiposity, impaired glucose metabolism and dyslipidaemia
22587663 GR Assembles at a Two-Site Promoter with substantial cooperativity.
22576823 The influence of glucocorticoid receptor and corticosteroid-binding globulin gene polymorphisms in obesity and/or cortisol action in prepubertal obese children.
22570980 Lack of mutations in the gene coding for the hGR (NR3C1) in a pediatric patient with ACTH-secreting pituitary adenoma.
22533504 A unique requirement for KIT Ligand in the upregulation of glucocorticoid receptor alpha isoform and optimal erythroblast expansion in cultures that mimic stress erythropoiesis.
22516993 The levels of GRalpha and GRbeta mRNA are related to the activity of systemic lupus erythematosus.
22516378 These studies show the mutual importance of c-Myb and the GR in controlling survival of pre-B acute lymphoblastic leukemia cells.
22507373 Results show that N363S and ER22/23EK polymorphisms of the NR3C1 gene are negatively associated with parameters of beta-cell function in women, but not in men
22487832 No significant difference was found between plasma lipid and glucose levels and various GR and ACTHR genotypes.
22469783 the N363S polymorphism of the h-GR/NR3C1 gene is significantly associated with an increased sensitivity to glucococorticoids in vivo and susceptibility to the development of a moderate to severe form of uncontrolled bronchial asthma in the Polish population
22444201 early-life events alter the expression of several hGR variants in the hippocampus of suicide completers through effects on promoter DNA methylation.
22441538 categorized immunoregulatory cellular profiles from PBMC of 207 healthy volunteers according to glucocorticoid receptor (GR: Bcl1, TthIIII, and A3669G) and beta-adrenergic receptor (beta2AR: Gly16Arg and Gln27Glu) polymorphisms
22427805 Potential importance of sequence variation within the NR3C1 gene in modulating glucocorticoid receptor mRNA expression in the dorsolateral prefrontal cortex.
22425674 Glucocorticoid receptor binding and chromatin remodeling in transcriptional activation. [Review]
22410078 Variations in the NR3C1 gene are related to enhanced amygdala activation during human fear conditioning, as well as to reduced prefrontal activation during extinction.
22371499 These studies identify a molecular mechanism of GR transrepression, and highlight the function of O-GlcNAc in hormone signaling.
22366879 Association study between glucocorticoid receptor gene polymorphisms and personality traits in healthy Japanese individuals.
22357529 GRA5556G, GRA5556G, GAGG4534/4536AAAG polymorphisms and ACTHR promoter T-2C variants might be associated with quantitative trait of stress.
22295073 childhood maltreatment or adversity may lead to epigenetic modifications of the human glucocorticoid receptor gene
22227972 Bayesian image analysis of dexamethasone and shear stress-induced glucocorticoid receptor intracellular movement
22205602 Modulation of SRp levels altered the GRbeta/alpha ratio that correlated with DEX responsiveness.
22185489 NFkappaB and glucocorticoid receptor activity in steroid resistance.
22177699 NRIP enhances HPV 16 gene expression via interaction with either GR or viral E2.
22174376 Global gene expression analysis revealed that glucocorticoid receptor (hGR)-dim4 cells widely regulated gene expression but differentially regulated apoptotic mRNA when compared with cells expressing wild-type hGRalpha.
22088926 This study observed a significant BcII x abuse interaction indicating genetic and environmental susceptibilities to co-occur significantly more often in bulimic than in nonbulimic individuals
22085474 This study contributes to the growing evidence for a role of the glucocorticoid receptor gene (NR3C1) in vulnerability to mood disorders, and BPD in particular.
22083731 This study demonstrated that NR3C1 and COMT markers exert their separate, as well as interactive, effects on DLPFC function.
22068557 Data indicate that polycystic ovary syndrome is associated with up-regulation of glucocorticoid receptor along with hyper-suppression of HPA axis (i.e., increased sensitivity to suppression by dexamethasone), and impairment of feedback inhibition.
22048965 The A3669G polymorphism of the GR gene plays a protective role in patients with CS, attenuating the effects of GC excess on glucose metabolism as shown by their reduced risk of diabetes.
22032841 Airway neutrophils have reduced GR expression compared to their peripheral blood counterparts and this reduced expression in airway neutrophils may be a mechanism contributing to glucocorticoid resistance in COPD patients
22018181 All the actions of the GR appear to play an important role in the regulation of the immune system.
22015776 The N363S polymorphism of NR3C1 gene is significantly associated with bronchial asthma, susceptibility to the development of moderate to severe form of uncontrolled bronchial asthma.
22008062 Association between BclI polymorphism in the NR3C1 gene and in vitro individual variations in lymphocyte responses to methylprednisolone
22003412 regulation of AF1 transactivation domain of the glucocorticoid recepto
21995950 Peripheral expression of glucocorticoid receptor co-chaperone genes may serve as a biomarker for risk of developing depressive symptoms during pregnancy.
21984896 These data suggest that DNA methylation decreases GR gene expression in human small cell lung cancer cells.
21980503 CLOCK-mediated circadian acetylation of the human GR may function as a target-tissue, gene-specific counter regulatory mechanism to the actions of diurnally fluctuating cortisol
21971518 Data suggest that in epicardial adipose tissue (versus subcutaneous adipose tissue) in patients with coronary artery disease various promoters (A, B, or C) of glucocorticoid receptor (GR) gene play roles in tissue-specific GR expression levels.
21945289 This study demonistrated that GR-ir in the DG correlated positively with age in the depressed but not the control group.
21930780 phosphorylation of Ser134 acts as a molecular sensor on the glucocorticoid receptor, monitoring the level of cellular stress to redirect glucocorticoid-regulated signaling through altered 14-3-3zeta cofactor binding and promoter recruitment
21912096 Alterations in hGR action may have important implications for many critical biological processes, such as the behavioral and physiological responses to stress, the immune and inflammatory reaction, as well as growth and reproduction.
21883217 Dexamethasone exposure results in binding of both glucocorticoid receptor and C/EBP-beta to the norepinephrine transporter promoter.
21881570 Total GR mRNA reductions in schizophrenia provide the first evidence of GR protein isoform abnormalities in schizophrenia and bipolar disorder.
21868756 In estrogen receptor negative breast cancer patients, high levels of NR3C1 expression were significantly correlated with a shorter relapse-free survival. In estrogen receptor positive patients, high NR3C1 levels were associated with a better outcome.
21853119 The p23 cochaperone of Hsp90, which plays a major role in glucocorticoid receptor folding and function, associates with influenza virus polymerase.
21803757 Genetic polymorphisms of the glucocorticoid receptor may affect the phenotype of women with anovulatory polycystic ovary syndrome
21789663 CRHR1, FKBP5 and NR3C1 gene variants are not associated with offspring depression symptoms from mothers with recurrent depression
21788965 the combination of GR and FKBP5 mutational analyses could help to identify subgroups of Crohn's disease patients with higher chances to benefit from Glucocorticoids treatment.
21764460 Polymorphisms of NR3C1 gene analyzed in this study may modify susceptibility to major depressive disorder and seem to influence the course of bipolar disorder.
21760925 The induced AF1 conformation facilitates its interaction with SRC-1, and subsequent AF1-mediated transcriptional activity.
21750107 coactivation of GR and NFKB alters signaling pathways that are regulated by each factor separately and provide insight into the networks underlying the GR and NFKB crosstalk.
21742609 Variable expression of GR in pituitary/adrenal cortex may contribute to variation in hypothalamic-pituitary-adrenal axis function; genetic variability in GR may contribute to pituitary/adrenal tumors or Cushing disease/syndrome. [REVIEW]
21664385 Glucocorticoids can stimulate directly mitochondrial transcription by the mitochondrially localized GR, affecting OXPHOS enzyme biosynthesis.
21646426 multiple distinct transcriptional patterns of GR and Brm interdependence
21641918 Results show that there is a relationship between ligand-specific transactivation efficacy, extent of nuclear translocation and recruitment of GR to the promoter.
21633323 these results suggest that variations in the GR/NR3C1 gene are associated with corticosteroid resistance and dependency in pediatric-onset Crohn's disease.
21531081 Polymorphisms of the GR-gene are factors which influence some clinical manifestations of bipolar disorder, with respect to seasonal pattern of (hypo)mania and age of onset.
21527497 the N-terminal translational isoforms of glucocorticoid receptor alpha selectively regulate antiapoptotic genes
21521940 this work is one of the first to link infant growth as a measure of the intrauterine environment and epigenetic alterations to the GR and suggests that DNA methylation may be a critical determinant of placental function.
21521257 Data show that the SNP's BclI and POMC C8246T of the HPA axis were primarily related to altered HPA axis functioning, rather than to altered anthropometric measurements and body composition.
21511880 the HSP90 molecular chaperone cycle regulates cyclical transcriptional dynamics of the glucocorticoid receptor and its coregulatory molecules CBP/p300 during ultradian ligand treatment
21489275 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
21477816 Haplotypic variation in the regulatory region of the NR3C1 may increase vulnerability to depressive disorders requiring hospital admission, but is not associated with self-reported symptoms.
21474440 Glucocorticoid-independent repression of tumor necrosis factor (TNF) alpha-stimulated interleukin (IL)-6 expression by the glucocorticoid receptor: a potential mechanism for protection against an excessive inflammatory response.
21473041 Factors determining the progress of glucocorticoid resistance in severe bronchial asthma with special acknowledgement of the influence of polymorphisms in glucocorticoid receptor gene h-GCR/NR3C1 to formation GCS resistance were studied.
21438768 We also measured the mRNA expressions of two GR gene isoforms during the stressful situations, and GRbeta expression was significantly reduced at the most stressful time point.
21438141 Altered GC signaling may be involved in the pathogenesis and development of delirium in the elderly.
21355091 GRbeta expression and the presence of A3669G likely contribute to development of erythrocytosis in Polycythemia vera and provide a potential target for identification of novel therapeutic agents.
21354648 Data show that glucocorticoid receptor expression and activity are indispensable for mineralocorticoid receptor-dependent induction of ENaC-mediated Na(+) transport.
21234764 This complexity within the CpG island helps to explain the variable, tissue-specific transcriptional control of the GR, and provides insight into the mechanisms underlying tissue specific deregulation of GR levels.
21190962 RSV infection of A549 cells does not alter GR protein levels or GR nuclear translocation but does reduce GR binding to the promoters of the glucocorticoid responsive genes.
21169818 homozygous BclI G allele carriers are at risk for traumatic memories, posttraumatic stress disorder symptoms, and lower health-related quality of life after cardiac surgery and intensive care unit therapy
21164266 Four genetic variants are described of which two (rs6198 and rs6189/6190) are associated with a relative glucocorticoid(GC) resistance and two (rs1695 and rs41423247) are associated with a relative GC hypersensitivity.
21148795 Cytoplasmic GR interacts with a subset of mRNA through specific sequences and can regulate turnover rates, a novel posttranscriptional role for GR as an RNA-binding protein.
21147850 TTC5 is a novel cofactor regulating GR function in a stress-dependent manner.
21146942 GR-9 beta polymorphism was significantly associated with left ventricular mass growth during the first 2 years.
21127044 the two GR target genes use alternate mechanisms to regulate expression levels at the level of continued transcription output after transcription machinery assembly.
21113676 The Bcl I polymorphism of h-GR/NR3C1 gene is significantly associated with bronchial asthma.
21093928 The result of this study findings as indicating that traumatic stress, when impacting individuals disposed to lower glucocorticoid receptor modulation, can be etiological for bulimia nervosa.
21084380 These data suggest a hormone activated, lineage-specific mechanism to control the autoup-regulation of hGR gene expression in 697 pre-B-ALL cells via steroid-mediated changes in GR coregulator expression.
21078539 Studies indicate that growth factors, angiogenic/lymphogenic factors, apoptosis-related factors and cytokines, which are related to the transition of prostate cancer from androgen dependence to hormone refractory status, are the targets of GR signaling.
21050724 Observational study of gene-disease association. (HuGE Navigator)
20885351 Observational study of genotype prevalence. (HuGE Navigator)
20861124 Novel, naturally occurring GR mutation that results in familial glucocorticoid resistance, predicted to exert dominant negative activity by impairing wild-type GR nuclear translocation.
20855522 Ginsenoside-Rg1 induces angiogenesis via non-genomic crosstalk of glucocorticoid receptor and fibroblast growth factor receptor-1.
20850457 Enhancing the stability and solubility of the glucocorticoid receptor ligand-binding domain by high-throughput library screening.
20841450 GR haplotypes and their effect on glucocorticoid sensitivity do not seem to play significant role in GH-induced catch-up growth and the risk factors of developing metabolic and cardiovascular disorders in adult life of small for gestational age children.
20841450 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20733583 Observational study of gene-disease association. (HuGE Navigator)
20731635 Our data provide the first evidence that GR modulates initiation of alcohol abuse and reveal a polymorphism that might contribute to susceptibility to addiction.
20731635 Observational study of gene-disease association. (HuGE Navigator)
20727199 The minor alleles of the 9beta and ER22/23EK polymorphisms seem to be associated with increased predisposition to develop rheumatoid arthritis
20727199 Observational study of gene-disease association. (HuGE Navigator)
20716560 Observational study of gene-disease association. (HuGE Navigator)
20712049 NR3C1 haplotypes are not related to steroid therapy outcome in inflammatory bowel disease.
20712049 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20697295 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20680430 NR3C1 and NR3C2 polymorphisms are not shown to affect heart rate and cortisol responses to a standardized social stress test in adolescents
20680430 Observational study of gene-disease association. (HuGE Navigator)
20661446 Glucocorticoid receptor exhibited strong interaction with CHIP, FKBP51 and TPR2.
20660302 AMPK regulates glucocorticoid actions on carbohydrate metabolism by targeting the glucocorticoid receptor (GR) and modifying transcription of glucocorticoid-responsive genes in a tissue- and promoter-specific fashion.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619282 the proteasome and the identified PEST degradation motif limit steroid-dependent human glucocorticoid receptor signaling
20602615 Observational study of gene-disease association. (HuGE Navigator)
20584071 Observational study of gene-disease association. (HuGE Navigator)
20561560 These results are consistent with a model whereby ligand-selective GR phosphorylation and half-life are a consequence of upstream events, such as ligand-specific GR conformations, which are maintained in the phosphorylation mutants.
20547006 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20545708 Evidence of an increased GR-beta expression in epithelial cells following IL-17 stimulation suggests a possible role for Th17-associated cytokines in the mechanism of steroid hypo-responsiveness in asthmatic subjects.
20543003 AP-1 and GR interaction increased after dexamethasone stimulation in asthmatic fibroblasts. AP-1 overexpression in control fibroblasts abrogated collagen gene response to Dex.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20488636 Association of GRbeta in eosinophilic chronic rhinosinusitis(ECRS). GRbeta immunoreactivity, an endogenous inhibitor of steroid action, may be major contributing factor in ECRS. GRbeta/GRalpha cell ratio in ECRS was elevated.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20484466 Results suggest that 1) the GR-beta variant by itself has no receptor function, but 2) GR-beta and GR-gamma have properties to exert dominant-negative effects on the GR-alpha-mediated trans-repression.
20472303 The NR3C1 polymorphisms (ER22/23EK )carriers had significantly lower cortisol responses to psychosocial stress compared with noncarriers.
20472303 Observational study of gene-disease association. (HuGE Navigator)
20450542 The expression of GCR in nuclear protein of peripheral blood lymphocyte and the bronchial biopsies, especially in bronchi, was significantly lower in COPD patients than in controls.
20448266 studies on function of glucocorticoid receptor & differences in signal transduction between proliferating cells (HeLa cells) & quiescent cells (primary hepatocytes)
20446002 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
20440229 The distribution of single nucleotide polymorphisms in glucocorticoid receptor in Italian patients with anorexia nervosa, bulimia nervosa, binge eating disorder, obese non-binge eating disorder patients and normal age-matched controls, was investigated.
20438742 Altered expression of GRalpha and GRbeta in CPA raises their possible role in the pathophysiology of these adrenal tumors.
20419394 GR is auto-induced in PBMCs in vitro and GR promoter 1A is involved in this mechanism; however the auto-upregulation of GR is not related with glucocorticoid response in patients with INS.
20403506 Observational study of gene-disease association. (HuGE Navigator)
20399565 GR as a key player in the precipitation, development and resolution of depression.
20376328 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20371666 Observational study of gene-disease association. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20347598 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
20335448 2-yr-old female case of generalized glucocorticoid resistance syndrome caused by a point mutation of the glucocorticoid receptor.
20308989 The results of this study indicate that a significant level of control over GRalpha is exercised across human cortical development
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20199670 in a large population-based cohort, no evidence was found for an effect of known glucocorticoid receptor gene polymorphisms on fetal and early postnatal growth characteristics
20199670 Observational study of gene-disease association. (HuGE Navigator)
20170710 There is a threshold level of GR transcripts/protein needed for cells to respond to the apoptosis-inducing effects of hormone.
20156759 chronic obstructive pulmonary disease is not linked to gene polymorphisms N363S, BCLI-RFLP, and ER2223EK.
20156759 Observational study of gene-disease association. (HuGE Navigator)
20156337 Glucocorticoid Response Elements (GREs) within the promoter regulatory regions of the Bcl-2 family members NOXA and Mcl-1 were identified, indicating that they are direct GR transcriptional targets.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20137628 BclI and ER22/23EK polymorphisms of glucocorticoid receptor have no definite relationship with the risk of myasthenia gravis.
20124551 Data show that that Gas5 is a "riborepressor" of the GR, influencing cell survival and metabolic activities during starvation by modulating the transcriptional activity of the GR.
20093418 Results indicate that the holo-GR is capable of activating transcription and evoking changes in chromatin structure through distant-acting enhancers.
20036846 studies indicate that GR beta acts as a dominant negative inhibitor of the splicing varant GR alpha mediated transactivation and transrepression in certain cell types.
20035271 Data show that lower levels of both glucocorticoid (GC) receptor alpha and NFkappaBp65 are associated with poor or no response to GCs and the difference is more pronounced in patients experiencing relapse of idiopathic nephrotic syndrome.
20032106 The expression of GRalpha in patients with systemic lupus erythematosus was low and there was a negative correlation between GRalpha expression and disease activity.
20018896 The results suggest that CREB-P is dephosphorylated and that HDAC-6 is recruited by the GR, and they play opposite roles in the negative feedback regulation of the GR gene.
20015871 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20015838 GR expression is pro-apoptotic for human SCLCs (small cell lung cancers) in vivo, as well as in vitro, suggesting that loss of GR confers a survival advantage to SCLCs.
20012529 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19940520 results suggset that GR haplotypes modulate the individual vulnerability for memory impairments related to stress-related psychiatric disorders in a sex-specific way
19940520 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19913032 The structures of three different conformations of the GR ligand binding domain mifepristone complex show in the oxosteroid hormone receptor family how helix 12 modulates LBD corepressor and coactivator binding.
19875955 nuclear immunoreactivity negatively correlates with breast cancer progression
19874574 Observational study of gene-disease association. (HuGE Navigator)
19841061 AF1, an ID activation domain of the glucocorticoid receptor (GR), adopts a functionally folded conformation due to its site-specific phosphorylation by p38 mitogen-activated protein kinase
19818358 Studies indicate glucocorticoid resistance has been ascribed to mutations in the hGR gene, which impair the molecular mechanisms of hGR action, thereby altering tissue sensitivity to glucocorticoids.
19805480 the cellular accumulation of IRF-1 may represent a potential molecular mechanism mediating altered cellular response to GC through the depletion of GRIP-1 from the GR transcriptional regulatory complexes
19801529 Overall, the genome-wide determination and analysis of GR:DNA binding and transcriptional response to hormone reveals new insights into the complexities of gene regulatory activities managed by GR.
19797430 cortisol, via binding to GR, stimulates COX-2 expression by increasing phosphorylated CREB-1 binding to the CRE of the COX-2 gene
19783104 a common haplotype of the GR gene (including the minor allele of the 9beta A/G polymorphism)is associated with depression.
19783104 Observational study of gene-disease association. (HuGE Navigator)
19782477 Differential expression of glucocorticoid receptor transcripts in major depressive disorder is not epigenetically programmed.
19779205 sLZIP functions as a negative regulator in glucocorticoid-induced transcriptional activation of GR by recruitment and activation of HDACs
19778524 These results indicate that ATP hydrolysis is essential for Bag-1M-mediated inhibition of the DNA binding by the GR and Hsp70 is a mediator for this process.
19758697 Polymorphisms -627A/G, intron 2 +646C/G and 9bT/C were all associated with reduced event-free survival.
19723618 Observational study of gene-disease association. (HuGE Navigator)
19691529 GR haplotypes are not a susceptibility factor for Guillain-Barre syndrome (GBS). However, haplotypes carrying the minor allele of the BclI polymorphism were related to the phenotype and outcome of GBS.
19691529 Observational study of gene-disease association. (HuGE Navigator)
19683543 AR was significantly reduced at 70 min post-exercise in men and at 10 min post-exercise in women compared to pre-exercise. There were no changes in GR following resistance exercise, but GR was significantly higher in women compared to men
19673019 Observational study of gene-disease association. (HuGE Navigator)
19646928 Expression of GRbeta in the colonic mucosa is associated with glucocorticoid resistance of ulcerative colitis patients.
19633971 In this review, the functions of GRbeta, its mechanisms of action, and its pathologic implications are discussed.
19628874 ANGPTL4 is a direct GR target that participates in glucocorticoid-regulated triglyceride metabolism.
19621425 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19605973 GR-alpha mRNA expression in peripheral blood mononuclear cells is repressed in proportion to the amount and frequency of the stressful stimuli due to athletic training.
19595997 These findings indicate a novel mechanism by which Bag-1M acts as a corepressor and downregulates the activity of the glucocorticoid receptor.
19586900 Estrogen inhibits glucocorticoid action via protein phosphatase 5 (PP5)-mediated glucocorticoid receptor dephosphorylation.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19570036 The interaction of Trx2 with GR is independent of the presence of GR ligand and of redox conditions.
19564704 TLR4 signaling and higher 11beta-HSD1 and GR levels in VAT may contribute predominantly to inflammatory factor production and subsequent metabolic sequelae in obese human.
19562035 expression of nestin is a major determinant in suppression of anti-proliferative activity of GR in undifferentiated tissue and facilitates activation of this growth control in a precise tissue and differentiation dependent manner
19548263 Observational study of gene-disease association. (HuGE Navigator)
19545546 knockdown of FKBP4 gene inhibited cortisol-activated GR nuclear translocation, while knockdown of FKBP5 was associated with increased baseline GR nuclear localization
19527514 Observational study of gene-disease association. (HuGE Navigator)
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19484926 GRalpha mRNA was significantly higher and GRbeta mRNA was significantly lower in patients with glucocorticoid-induced ocular hypertension than in normal controls.
19466222 The N363S polymorphism prevalence is low in the Brazilian population, although its presence may contribute to the worsening of individuals' metabolic profiles.
19463884 AhR functionally cross-reacts with the GR, through which transactivation activity of the GR is further enhanced, and in contrast, transactivation activity of the AhR is inhibited.
19458171 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
19453261 Observational study of gene-disease association. (HuGE Navigator)
19450611 Hypoxia down-regulates GRalpha expression in alveolar epithelium and this impairs anti-inflammatory actions of dexamethasone.
19450127 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19435830 NR3C1 gene expression in 240 lymphoblastoid cell lines identified one SNP, Cm746T>C, located 5'-upstream of noncoding exon 1C, and one haplotype, Cm237delC/Cm238C>T/Cm240G>C in exon 1C of the gene.
19429432 Data demonstrate a significantly higher frequency of the glucocorticoid receptor BclI polymorphism in Crohn disease patients than in healthy volunteers.
19429432 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19413563 We were not able to replicate the earlier findings indicating that the proportion of current smokers is lower among carriers of the CC-genotype of the BclI glucocorticoid receptor.
19413563 Observational study of gene-disease association. (HuGE Navigator)
19375647 GR became associated with the EPO receptor and STAT-5 in cells stimulated with EPO and DXM
19373457 Neutrophils from sepsis patients showed decreased levels of glucocorticoid receptor mRNA of the GR-alpha and GR-P splice variants on day 0 compared to after recovery. GR-alpha and GR-P mRNA levels normalized after recovery
19372434 study shows GR binding sequences, differing by as little as a single base pair, differentially affect GR conformation & regulatory activity; propose DNA is a sequence-specific allosteric ligand of GR that tailors receptor activity toward target genes
19365399 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19336230 Observational study of gene-disease association. (HuGE Navigator)
19318444 Multiple sclerosis patients carrying the haplotype 6 (TthIIII, ER22/23EK, and 9beta) have a more aggressive disease course.
19318444 Observational study of gene-disease association. (HuGE Navigator)
19282465 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19275585 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
19275583 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
19275580 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19248771 These results indicate that GRbeta has intrinsic, GRalpha-independent, gene-specific transcriptional activity, in addition to its previously reported dominant negative effect on GRalpha-induced transactivation of GRE-driven promoters.
19241242 protective role of the ER22/23EK polymorphism against an excessive weight gain and excessive increase of body mass index during uncomplicated pregnancy
19241242 Observational study of gene-disease association. (HuGE Navigator)
19234457 Post hoc tests show that expression of total glucocorticoid receptor mRNA is significantly reduced in suicide victims with a history of childhood abuse relative to nonabused suicide victims or controls.
19234455 Glucocorticoid receptor inactivation in dopamine receptor 1a-expressing neurons, but not in dopamine-releasing neurons, reduces the motivational properties of cocaine in transgenic mice.
19230884 Only the Bcl I polymorphism of the glucocorticoid receptor gene is common in the Chinese Han population; it may not influence the development of complications following major trauma.
19230884 Observational study of gene-disease association. (HuGE Navigator)
19222494 we found an association between the presence of the G-allele of the Bcl1 polymorphism in the glucocorticoid receptor gene and higher body weight, BMI and, most importantly, body fat mass in boys in a healthy young population
19222494 Observational study of gene-disease association. (HuGE Navigator)
19207316 Contrary to healthy subjects, however, the BclI polymorphism of the GR gene may modify the skeletal sensitivity to glucocorticoids in patients with endogenous glucocorticoid excess.
19207316 Observational study of gene-disease association. (HuGE Navigator)
19188741 GR haplotype might play a role in growth of children born SGA, reflected by the decreased prevalence of GR haplotype 2 (Bcl1) in this group.
19188741 Observational study of gene-disease association. (HuGE Navigator)
19183974 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19177170 The cross talk between the two main signaling pathways involved in activation and repression of corticotrophin releasing hormone (CRH) mRNA expression: cyclic AMP (cAMP) and GR, was investigated.
19174530 Observational study of gene-disease association. (HuGE Navigator)
19146914 GR plays an indispensable role in mineralocorticoid receptor-dependent transcription, possibly by forming a MR/GR heterodimer or by acting as a co-activator of MR/MR homodimer
19133972 The exon 9beta polymorphism and the TthIIII polymorphism of the GR gene may be associated with a protective effect on the clinical manifestation and course in patients with bipolar disorder.
19133972 Observational study of gene-disease association. (HuGE Navigator)
19100874 Together with glucocorticoid receptor , beta-catenin could thus be co-transported from the nucleus in a calreticulin-dependent way
19095219 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19089807 Our data suggest that while none of the SNPs genotyped in the current study are likely to be directly involved in the etiology of Childhood onset mood disorders (COMD), haplotypes across NR3C1 may incur susceptibility.
19089807 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19074285 dissect the GRIP1:Suv4-20h1 interaction in vitro and in vivo and examine its potential involvement in hormone-dependent transcriptional regulation by GR
19051288 A gene-environment interaction between common variants of the GR gene and childhood adversity, demonstrating a vulnerable phenotype for developing clinically relevant depressive symptoms at old age.
19051288 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19008334 The SCAN- and KRAB-domain-containing zinc finger protein 307 (ZKSCAN4) was co-precipitated with the receptor when both proteins were overexpressed in HEK293 cells.
19007849 Persistent repression by glucocorticoids targets glucocorticoid responsive genes using a chromatin-dependent mechanism that disrupts binding of both GR-dependent and GR-independent transcription complexes.
19007848 GR-mediated ligand-selective differential interaction with GRIP-1, SRC-1A, NCoR and SMRT is a major determinant of ligand-selective and promoter-specific differences in potency and efficacy, for both transactivation and transrepression.
19005987 we found no statistically significant relationship between glucocorticoid receptor polymorphisms and IOP (intraocular pressure) elevation following intravitreal triamcinolone acetonide.
19005987 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18983327 The genetic information about GRL would be useful for further genetic study of obesity, diabetes, and related metabolic diseases.
18983327 Observational study of gene-disease association. (HuGE Navigator)
18958157 By blocking GR activation, dibutyltin may disturb metabolic functions and modulation of the immune system, providing an explanation for some of the toxic effects of this organotin.
18952539 No association of glucocorticoid receptor polymorphisms with asthma and response to glucocorticoids.
18952539 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18945813 A conserved molecular mechanism is responsible for the auto-up-regulation of glucocorticoid receptor gene promoters.
18854398 Excess heterodimerization with the active GRalpha isoform may reduce glucocorticoid receptor (GR) signaling with subsequent physiological effects on blood pressure regulation.
18854398 Observational study of gene-disease association. (HuGE Navigator)
18838540 Results describe a convergence point of the GSK-3beta and the glucocorticoid receptor pathways, and suggest a mechanism by which GSK-3beta activity can dictate how cells will ultimately respond to glucocorticoids.
18838498 Observational study of gene-disease association. (HuGE Navigator)
18830906 GR-alpha and GR-beta polymorphisms are potentially associated with rheumatoid arthritis susceptibility.
18830906 Observational study of gene-disease association. (HuGE Navigator)
18827003 The presence of the D401H mutation in gccr may predispose subjects to obesity, hypertension, and other manifestations of the metabolic syndrome
18822299 These findings identify a regulatory mechanism, downstream of hormone binding, used by Bag-1M for attenuating GR action in response to its changing cellular levels.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18812484 We did not find differences in cardiovascular risk factors between GR haplotypes
18812484 Observational study of gene-disease association. (HuGE Navigator)
18801933 HEXIM1 may participate in tissue-selective determination of glucocorticoid sensitivity via direct interaction with GR at least in certain gene sets including atp1a1 and scnn1a.
18789525 glucocorticoid resistance could not be attributed to mutations in GR or variations in levels of its expression
18772142 GR directly bound to the two glucocorticoid-response element-like sequences in the human CALD1 promoter and transactivated the CALD1 gene, thereby up-regulating the CaD protein.
18728163 The human placenta expresses a variety of GR mRNA transcripts
18668364 High Glucocorticoid Receptor expression is associated with breast cancer with older patient age.
18663733 two functional GR SNPs in linkage disequilibrium are responsible for both regulation of GR expression and mRNA stability.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18595687 Association between birth weight in preterm neonates and the BcII polymorphism of the GR gene is reported.
18583474 Study discovered that FAM33A is protein partners for GRs and is involved in cell proliferation and GC signalling.
18536531 Methylation status of the human NR3C1 gene in newborns is sensitive to prenatal maternal mood and may offer a potential epigenetic process that links antenatal maternal mood and altered hypothalamic-pituitary-adrenal stress reactivity during infancy.
18515658 reexpression of wild-type GR restored GRE transactivation, NF-kappaB transrepression, RAFTK phosphorylation, Bim induction, and dexamethasone-induced apoptosis in a dexamethasone-resistance MM1R cell line
18510611 Observational study of gene-disease association. (HuGE Navigator)
18502562 Observational study of gene-disease association. (HuGE Navigator)
18483179 GR phosphorylation at S211 and S226 determines GR transcriptional response by modifying cofactor interaction.
18468809 The lower GR and MR expression and possibly the reduced MR function, may be associated with an impaired function of the HPA axis in fibromyalgia patients.
18417736 DAX-1 directly modulates GR signaling in addition to affecting glucocorticoid hormone levels
18408151 GR occupancy of the GR-binding sequences (GBS) motif correlates with induction but not repression, and GBS conservation alone is sufficient to predict GR occupancy and GRE function at induced genes
18407829 HEXIM1 may act as a gene-selective transcriptional regulator via direct interaction with certain transcriptional regulators including glucocorticoid receptor.
18398271 cases of Cushing's syndrome with putative glucocorticoid receptor dysfunction exist, and we report one such likely case
18396779 GR-alpha may play the major role in the inflammation associated with nasal polyps.
18385010 Observational study of genetic testing. (HuGE Navigator)
18362306 A homozygous G679S mutation of the GR-alpha gene is associated with severe cortisol resistance, whereas a heterozygous mutation of the same gene can lead to subclinical cortisol resistance.
18343955 Examine response to prednisone in relation to NR3C1 intron B polymorphisms in childhood nephrotic syndrome.
18343955 Observational study of gene-disease association. (HuGE Navigator)
18337589 Phosphorylation aids GR sumoylation and that cross talk of JNK and SUMO pathways fine tune GR transcriptional activity.
18331827 AngRem104 is involved in the in vivo regulation of GR expression and the activation of NF-kappaB through interaction with GR-EF in human MCs.
18295813 The data suggest that steroids can overcome the restriction on HIV provirus formation by binding to glucocorticoid receptor and thereby increase the reservoir of virus producing cells.
18295813 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
18286599 Unipolar depression is associated with DNA variants of the NR3C1 gene in our population; volumetric reductions of the hippocampus may also be mediated by variants in this gene.
18286599 Observational study of gene-disease association. (HuGE Navigator)
18269582 Distribution of glucocorticoid receptor expression is markedly diverse among tissues of the human digestive system.
18248637 GR genotypes modify the relationship between muscle mass and muscle strength.
18248637 Observational study of gene-disease association. (HuGE Navigator)
18246526 Glucocorticoid receptor polymorphism is associated with major depression and greater abdominal obesity
18246526 Observational study of gene-disease association. (HuGE Navigator)
18219286 Meta-analysis of gene-disease association. (HuGE Navigator)
18195193 Observational study of gene-disease association. (HuGE Navigator)
18194492 This study reported that polymorphism rs2918419 was linked with hyperinsulinaemia and insulin resistance in men.
18194492 Observational study of gene-disease association. (HuGE Navigator)
18182467 both mineralocorticoid and glucocorticoid receptors may be involved in the multiple mechanisms controlling counterregulatory responses to hypoglycemia in healthy man
18165172 Preliminary findings suggest that increased expression of GRbeta isoform may be associated with relatively more severe clinical presentation of systemic lupus erythematosus syndrome.
18160712 The crystal structure of the GR LBD bound to DAC & the fourth LXXLL motif of steroid receptor coactivator 1 reveals that the GR ligand binding pocket is expanded to a size of 1,070 A(3), doubling its size but leaving the coactivator binding site intact.
18156379 Observational study of gene-disease association. (HuGE Navigator)
18156379 The significant association between the frequency of the polymorphic BclI allele and ATA stage distribution suggests that this polymorphism of the GR gene may affect clinical manifestations of Graves ophthalmopathy
18096310 Set/TAF-Ibeta acts as a ligand-activated GR-responsive transcriptional repressor, while Set-Can does not retain physiologic responsiveness to ligand-bound glucocorticoid receptor.
18086889 These studies suggest BAF250a is a necessary facilitator of BRG1-mediated chromatin remodeling required for SWI/SNF-dependent transcriptional activation.
18079322 The endogenous glucocorticoid receptor exert both ligand-dependent and -independant suppressive effects on surfactant protein A expression via its interaction with NF-kappaB p65 and thyroid transcription factor- 1 bound to the TTF-1 binding element.
18047640 The BclI polymorphism may modulate the inflammatory burden in the cystic fibrosis lung and in this way influence progression of lung function.
18028994 GRbeta is able to act as a transcriptional repressor of cytokine genes, IL5 and IL13 and mediates its function through the recruitment of histone deacetylase complexes.
17989362 The effect of cell density and inflammatory conditions on the expression, compartmentalization, activation, and the anti-proliferative function of the GR in primary human lung fibroblast cultures, was studied.
17952860 Breast cancer progression is associated with the accumulation of glucocorticoid receptor in the cytoplasm of tumoral cells and the decrease of COX-2 expression.
17951535 GR and C/EBPalpha were involved in cortisol-induced 11beta-HSD1 mRNA expression via binding to 11beta-HSD1 promoter in amnion fibroblasts.
17937535 For the first time, our study suggested the possible role of the GR gene on BMD regulation and sex specificity in the association of GR with extreme BMD in the Chinese.
17937535 Observational study of gene-disease association. (HuGE Navigator)
17853270 Binding site located in the hippocampal glucocorticoid receptor gene (Nr3c1) exon 1(7) promoter, leads to decreased Nr3c1 expression.
17848410 Observational study of gene-disease association. (HuGE Navigator)
17848410 Carriers of the 23K variant in the glucocorticoid receptor are protected against postnatal growth failure and insulin resistance after preterm birth
17716631 Observational study of gene-disease association. (HuGE Navigator)
17716631 Significant sex specific associations were found between glucocorticoid receptor gene polymorphisms and HPA axis responses to psychosocial stress as well as glucocorticoid sensitivity.
17704997 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17682054 Results suggest that translational glucocorticoid receptor isoforms can elicit distinct glucocorticoid responses.
17681029 Higher cortisol levels are associated with lower femoral neck BMD in elderly women. The G allele of the 9beta polymorphism was associated with lower serum cortisol levels in women
17681029 Observational study of gene-disease association. (HuGE Navigator)
17635946 The mutant receptor hGRalphaF737L causes glucocorticoid resistance because of decreased affinity for the ligand, delay in nuclear translocation, and/or abnormal interaction with the glucocorticoid receptor-interacting protein 1 coactivator
17633260 The high expression of GR beta in nasal polyp is related to the development of nasal polyp.
17633252 GR-alpha mRNA level in the adenoidal tissues in OSAHS patients was lower than those in non-OSAHS controls. There was no difference in GR-beta levels.
17602195 CTGF is a functional target of aldosterone in mesangial cells, but aldosterone-induced CTGF gene expression is not directly mediated by the mineralocorticoid receptor.
17592773 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17572486 GRalpha may be involved in transcriptional regulation of P-glycoprotein in placental trophoblast. CYP3A4 & CYP2C9 genes are not inducible through GRalpha in placental cell lines, due to lack of HNF4alpha expression
17563720 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17563720 In cases where prednisolone acetate was administered, we found a significant correlation between N363S heterozygosity and steroid-induced ocular hypertension.
17559307 GR occupancy is a primary determinant of glucocorticoid responsiveness, and core GR binding sequences as well as GRE architecture likely harbor gene-specific regulatory information
17556642 Years 2 to 3 of life were a critical period: the participants whose families owned homes during these childhood years showed higher GR mRNA and lower TLR4 mRNA during adolescence, a profile that suggests better regulation of inflammatory responses
17552871 evidence presented for regulatory cross-talk between aryl hydrocarbon receptor and glucocorticoid receptor alpha in HepG2 cells.
17540466 Results suggest that bombesin-induced expression of SRp30c affects gllucorticoid receptor (GR) pre-mRNA splicing, leading to increased GR beta expression and contributing to glucocorticoid resistance in PC cells.
17535992 functional assays revealed only minor differences between the wild-type glucocorticoid receptor and N363S receptors in both transiently and stably expressing cell lines
17532759 In this study of the most comprehensive coverage of GR polymorphisms with rheumatoid arthritis, no significant contributing role for GR polymorphisms was found.
17532759 Observational study of gene-disease association. (HuGE Navigator)
17522428 Observational study of gene-disease association. (HuGE Navigator)
17517920 Data show that conditional glucocorticoid receptor expression in the heart induces atrio-ventricular block.
17512111 progesterone and glucocorticoid, but not estrogen receptor mRNA are altered in breast cancer stroma
17496926 A profound apoptotic effect of glucocorticoid receptor (GR) in small cell lung cancer (SCLC) cells may explain the low levels of endogenous GR in SCLC cells.
17490654 Ginsenoside-Re is an agonistic ligand for the glucocortiod recept which in turn induces rapid calcium influx and nitric oxide production in endothelial cells.
17460547 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17442162 The increased expression of GRalpha mRNA and decreased GRalpha: GRbeta ratio in orbital tissues may play an important role in the pathogenesis of thyroid associated ophthalmopathy.
17438138 For the glucocorticoid receptor (GR), inhibition of proteasome-mediated proteolysis or RNA interference-mediated depletion of specific proteasome subunits results in an increase in gene expression.
17407502 Observational study of gene-disease association. (HuGE Navigator)
17404046 Novel splice variant hGRDelta313-338 represents a glucocorticoid receptor isoform with an altered glucocorticoid-induced transactivation profile.
17395275 Observational study of gene-disease association. (HuGE Navigator)
17395275 The ER22/23EK polymorphism was associated with a more aggressive MS phenotype, measured both clinically and on MRI.
17392827 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17382897 Overexpression of TrxR1 markedly increased GR activity in outer root sheath cells cultured in vitro. In addition, thioredoxin reductase 1 protected GR activity against H(2)O(2).
17291258 Observational study of gene-disease association. (HuGE Navigator)
17242172 Regulation of splice variants could partly occur through selective use of the multiple promoters.
17242171 Two additional possible first exons are mapped.
17239375 diffusion properties of EGFP-GRalpha and mutants C421G, A458T and I566 in living cells
17236775 GRalpha is of significance in meningiomas; however, GRalpha's expression had no obvious effect on the proliferative activity of meningiomas.
17186943 the chromatin architecture of the promoters does not permit strong association of GR in the absence of NF1
17185395 GR undergoes a phosphorylation/dephosphorylation cycle that maintains steady-state receptor phosphorylation at a low basal level in the absence of ligand.
17184882 Observational study of gene-disease association. (HuGE Navigator)
17167179 Hypermethylation was subsequently identified for three of four analyzed genes, ADAMTS1 (85%), CRABP1 (90%), and NR3C1 (35%).
17133261 Observational study of gene-disease association. (HuGE Navigator)
17133261 no differences in cognitive functioning were observed dependent on the polymorphisms in the MR and GR genes in older adults.
17116691 STAMP is an important new, downstream component of GR action in both gene activation and gene repression.
17070695 Role of GR in major depression.
17065567 Immunohistochemistry (demonstrated no overt difference between CDH, hypoplastic, and control lungs, either in the localization nor the timing of the first expression of glucocorticoid, retinoid, and thyroid hormone receptors
17043312 Brg1 and HDAC2 have roles in GR trans-repression of the pituitary POMC gene and misexpression in Cushing disease
16980656 data suggest that the N363S GRL polymorphism may be implicated in the long term response to glucocorticoids in patients with Duchenne muscular dystrophy
16973758 a negative cross talk between PR and Stat5a/GR may contribute to the physiological role of progesterone to repress lactogenic hormone induction of the beta-casein gene
16971495 Acute effect of glucocorticoids on NHE3 is mediated by a glucocorticoid receptor dependent mechanism that activates SGK1 in a nongenomic manner.
16914312 These data suggest that although LXXLL motifs in helices 1 and 10 appear to lie outside the predicted ligand binding pocket they may contribute to receptor ligand binding affinity.
16895953 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16890204 Observational study of gene-disease association. (HuGE Navigator)
16890204 genetic variations of NR3C1 in children with sporadic steroid-resistant nephrotic syndrome & sporadic steroid-sensitive NS; no causative mutations were found; 6 previously identified & 6 novel polymorphisms were detected & 2 novel haplotypes identified
16855182 Observational study of gene-disease association. (HuGE Navigator)
16849409 Observational study of gene-disease association. (HuGE Navigator)
16809634 Importin 13 promotes nuclear occupancy of glucocorticoid receptor to potentiate antiinflammatory effects of glucocorticoids.
16806906 Observational study of genetic testing. (HuGE Navigator)
16806572 Glucocorticoid receptor is expressed in advanced non-small cell lung cancer
16759008 GR-beta may play an important role in evaluating the effect of glucocorticoids in chronic sinusitis and nasal polyps.
16740143 Observational study of gene-disease association. (HuGE Navigator)
16740143 Results demonstrate NR3C1 as a potential mediator of chronic fatigue, and implicate variations in the 5' region of NR3C1 as a possible mechanism through which the alterations in HPA axis regulation and behavioural characteristics of CFS may manifest.
16728546 Observational study of genotype prevalence. (HuGE Navigator)
16725041 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16725041 No compelling evidence that the N363S polymorphism of the GRL gene is associated with either average body mass index or obesity risk.
16684836 Observational study of gene-disease association. (HuGE Navigator)
16684836 persons carrying the glucocorticoid receptor 9beta haplotype seem to have a decreased Glucocorticoid transrepression with normal transactivation
16676134 Observational study of gene-disease association. (HuGE Navigator)
16676134 We conclude that, in spite the effect of the ER22/23EK and N363S SNPs on metabolism, these polymorphisms together with the BclI SNP, do not affect the risks of cardiovascular disease and survival at old age.
16648810 Observational study of gene-disease association. (HuGE Navigator)
16638864 Observational study of gene-disease association. (HuGE Navigator)
16636127 Observational study of gene-disease association. (HuGE Navigator)
16636127 results suggest that the N363S variant of the glucocorticoid receptor (GR) gene may play a role in the pathogenesis of bilateral adrenal incidentalomas
16624805 human ERK8 has a role as a negative regulator of human GRalpha, acting through Hic-5
16621324 intracellular signaling of GR, AP-1 and JNK are altered in BD and may underly disease aetiopathogenesis and/or reflect the effect of the anti-depressants
16615046 Correlation between glucocorticoid receptor number & affinity for ligand, as well as relationship between these equilibrium binding parameters & body mass index, blood pressure, & age were examined in peripheral blood mononuclear cells of healthy humans
16610957 Observational study of gene-disease association. (HuGE Navigator)
16610949 Observational study of gene-disease association. (HuGE Navigator)
16580345 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16580345 The BclI and ER22/23EK polymorphisms of glucocorticoid receptor were associated with susceptibility to develop major depression.
16469772 TBP-GR interaction is functionally significant
16458268 reduced GRalpha mRNA expression might be trait-dependent and associated with the pathophysiology of mood disorders.
16450310 Expresssed in the zona reticularis of the adrenal cortex.
16446173 Present article reviews the data about a possible role for glucocorticoid receptor beta in the development of glucocorticoid resistance in inflammatory diseases, such as rheumatoid arthritis and septic shock.
16429131 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
16387802 RNA silencing of GCRbeta mRNA in human BAL macrophages from patients with GC-insensitive asthma resulted in enhanced dexamethasone-induced GCRalpha transactivation.
16319314 Spinal glucocorticoid receptor through the cAMP-CREB pathway played a significant role in NMDAR and PKCgamma expression after chronic morphine exposure.
16263717 c-Myb and c-Ets family members (Ets-1/2, PU.1, and Spi-B) control hGR 1A promoter regulation in T- and B-lymphoblast cells
16239257 MED14 and MED1 are used by glucocorticoid receptor in a gene-specific manner, providing a mechanism for promoter selectivity by glucocorticoid receptor
16222046 There was an association between the BcII polymorphism and salivary cortisol, but no association for obesity.
16216909 Analysis of the 5' untranslated region of the human glucocorticoid receptor (hGR) has revealed 11 splice variants of exon 1, based on seven exon 1s, four of which were previously unknown.
16204701 Review. The presence of multiple GR monomers and dimers in different quantities with quantitatively and qualitatively different transcriptional activities suggests that the glucocorticoid signaling system is highly stochastic.
16192984 Observational study of gene-disease association. (HuGE Navigator)
16189295 When tested in HT29 cells, MPA could only stimulate alpha-ENaC-driven reporter activity when GR was coexpressed, confirming the requirement for functional GR in the transcriptional effect of MPA.
16134770 The increased expression of GR beta mRNA may be related to the ineffectiveness of glucocorticoids for the treatment of AS.
16131566 platelet GR forms a heterodimeric complex with the mineralocorticoid receptor that is susceptible to differential activation by specific receptor ligands
16083972 Observational study of gene-disease association. (HuGE Navigator)
15956716 In three different cell lines, relaxin induced GR activation, nuclear translocation, and DNA binding as assessed in glucocorticoid response element (GRE)-luciferase assays
15955845 We conclude that the Gbetagamma complex interacts with the GR and suppresses its transcriptional activity by associating with the transcriptional complex formed on GR-responsive promoters.
15933212 role in transcriptional regulation of CYP2C8
15919839 Observational study of gene-disease association. (HuGE Navigator)
15919839 study suggests that, in men developing obesity early in life, polymorphism of the glucocorticoid receptor gene is associated with less adiposity at a given body mass index, leading to higher insulin sensitivity
15916966 Results identify Hsp90 as a target of HDAC6 and suggest reversible acetylation as a unique mechanism that regulates Hsp90 chaperone complex activity in maturation of the glucocorticoid receptor.
15895983 New, alternatively spliced transcripts of glucocorticoid receptor alpha subunit may have physiologically relevant roles that might be manifested in a cell type-specific manner and could potentially affect hormone sensitivity or resistance in leukemia.
15879558 Glucocorticoid receptor blocks P-TEFb recruitment by NFkappaB to effect promoter-specific transcriptional repression.
15866175 Results suggest that cell-type specific glucocorticoid receptor isoforms generate specificity in glucocorticoid control of transcription in different tissues.
15862824 discussion of glucocorticoid receptor gene and protein [review]
15832179 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
15826950 interleukin-5 transcription repression by the glucocorticoid receptor targets GATA3 signaling and involves histone deacetylase recruitment
15797250 PPARalpha has a role in CYP4X1 regulation, and the glucocorticoid and progesterone receptors have roles in CYP4Z1 gene activation
15774500 structural analysis of glucocorticoid receptor point mutation V571M
15770078 Observational study of genotype prevalence. (HuGE Navigator)
15770078 Relatively frequent SNP Asn363Ser found in Caucasians and African-Americans. Thus, ethnic differences between Japanese and other races are suggested to exist in NR3C1.
15769988 Carboxyl terminus of the ligand-binding domain is extremely important in conferring transactivational activity by altering multiple functions of this composite transcription factor.
15761032 glucocorticoid receptor down-regulation and transactivation is mediated by CHIP, an E3 ligase, through the ubiquitin-proteasome pathway
15755863 A possible indicastion for selection of synthetic glucocorticoids for treatment of pathological conditions in which hGR beta modulates the sensitivity of tissues to glucocorticoids.
15746190 The molecular basis for the reduced GC sensitivity was elucidated by investigating the influence of the ER22/23EK polymorphism on synthesis of GR-A and GR-B isoforms.
15725353 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
15713213 Observational study of gene-disease association. (HuGE Navigator)
15698551 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
15638722 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
15611350 Glucocorticoid receptor alpha is expressed in adenotonsillar tissue of children with obstructive sleep apnea
15591061 FK506-binding proteins 51 and 52 differentially regulate dynein interaction and nuclear translocation of the glucocorticoid receptor
15590693 Glucocorticoid receptor-induced MPK-1 expression inhibits paclitaxel-associated MAPK activation and contributes to breast cancer cell survival
15576464 the interferon signaling pathway and the human glucocorticoid receptor gene 1A promoter interact in T-lymphocytes
15576061 GR mRNA expression was reduced in the basolateral/lateral nuclei in schizophrenia and bipolar disorder.
15557560 results demonstrate a rational mechanistic basis for UGT1A1 induction by glucocorticoids and PXR activators, showing that activated glucocorticoid receptor enhances CAR/PXR-mediated UGT1A1 regulation with the transcriptional cofactor GRIP1
15550679 The inability of GRR488Q to repress NF-kappaB was not related to its inability to activate target genes through a glucocorticoid response element.
15545613 an induced-fit mechanism gives structure to the glucocorticoid receptor AF1 domain when it encounters TATA box binding protein
15531761 the interaction between PPARgamma and GR may be responsible for the additive and synergistic inhibition of chemokine expression by PPARgamma agonists, glucocorticoids, and beta(2)-agonists
15521959 Observational study of gene-disease association. (HuGE Navigator)
15511603 Observational study of gene-disease association. (HuGE Navigator)
15501915 role of GR in glucocorticoid-regulated gene expression
15497438 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15462611 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15459252 hGRbeta suppresses the transcriptional activity of hGRalpha by competing with hGRalpha for binding to GRIP1, and possibly other p160 coactivators, through its preserved AF-1
15380361 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
15292341 Observational study of gene-disease association. (HuGE Navigator)
15292341 The ER22/23EK polymorphism is associated with a sex-specific, beneficial body composition at young-adult age, as well as greater muscle strength in males
15289446 relaxin acts as GR agonist--a pathway pivotal to its effects on cytokine secretion by human macrophages
15276593 Observational study of gene-disease association. (HuGE Navigator)
15265780 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
15212141 Observational study of gene-disease association. (HuGE Navigator)
15212141 a mutation of the glucocorticoid receptor gene may have a role in development of systemic lupus erythematosus
15171715 Results reveal differential modulatory roles of the protein inhibitor of activated STAT proteins on the transcriptional properties of mineralocorticoid and glucocorticoid receptors.
15159550 Data report the crystal structures of two overlapped fragments of FK506-binding protein 52 and the heterocomplex of glucocorticoid receptors with heat-shock proteins 90.
15142377 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
15062560 the role of Hsp90 in nuclear retention of GR after ligand withdrawal
15044598 promoter has several different steroid-responsive sequences
14764810 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14764763 Observational study of gene-disease association. (HuGE Navigator)
14749509 Observational study of gene-disease association. (HuGE Navigator)
14733805 Observational study of gene-disease association. (HuGE Navigator)
14733805 Twelve polymorphisms in the NR3C1 gene were detected, two types of newly found haplotypes were associated with steroid-resistant idiopathic nephrotic syndrome, which might be responsible for steroid-resistance in partial idiopathic nephrotic syndrome.
14715855 Observational study of gene-disease association. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
14617768 identified genes transcriptionally activated by GR, in a translation-independent manner, in two human cell lines
14616881 Observational study of gene-disease association. (HuGE Navigator)
12974633 GRalpha transcripts containing exons 1A3, 1B, and 1C contribute most to the intracellular level of GR mRNA and may be the most relevant for steroid-mediated apoptosis in T-lymphoblasts
12920235 Identification of the novel GRV575M variant in human bronchial epithelial cells using a molecular genetic selection scheme
12903052 Data show that the G allele may be a predisposing gene marker, glucocorticoid receptor gene intron 4 polymorphism contributes to the development of cerebral infarction in females.
12903052 Observational study of gene-disease association. (HuGE Navigator)
12902338 the ligand-binding domain of GR, but not the DNA-binding domain or the N-terminal activation domain, is required for GR-mediated transrepression of TGF-beta transactivation
12864802 Observational study of gene-disease association. (HuGE Navigator)
12843156 Observational study of gene-disease association. (HuGE Navigator)
12810720 glucocorticoid receptor has a role in regulation of hypoxia-dependent gene expression
12807506 Observational study of gene-disease association. (HuGE Navigator)
12805402 Observational study of gene-disease association. (HuGE Navigator)
12773573 investigation of dominant negative function of human glucocorticoid receptor beta
12754700 REVIEW: pathological and in vitro mutations and polymorphisms
12748280 Data show that differential recruitment of coactivators by progesterone and glucocorticoid receptors determines the assembly of coactivator complexes on target promoters to mediate specific transcription signals.
12738786 Serine-arginine-rich protein p30 directs alternative splicing of glucocorticoid receptor pre-mRNA to glucocorticoid receptor beta in neutrophils.
12711001 there are non-hormone-binding receptor forms of glucocorticoid receptor in addition to the native heterocomplex
12642036 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
12637494 Glucocorticoid receptor activates Bcl-XL during tumorigenesis
12634356 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
12623935 Observational study of gene-disease association. (HuGE Navigator)
12623935 Association of coronary artery disease with glucocorticoid receptor N363S variant.
12612067 Ligand binding induces a conformational change dependent on ligand affinity. This decreases receptor mobility, probably by targeting it to relatively immobile nuclear domains with which it transiently associates. This also blocks immobilization by MG132.
12581885 data support the existence of a new pathway involving hSur2 for modulating GR transactivation processes
12477485 The results of homology modelling of the human glucorticoid receptor (hGR) ligand-binding domain (LBD) based on the ligand-bound domain of the human estrogen receptor alpha (hERalpha) are reported.
12444143 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
12430185 We identified a novel heterozygous mutation (C643R) in the ligand-binding domain in P30/OHK cells
12379213 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
12351702 These findings suggest that JNK-mediated phosphorylation of the GR-Ser226 enhances GR nuclear export and may contribute to termination of GR-mediated transcription.
12351458 Observational study of gene-disease association. (HuGE Navigator)
12237292 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
12237016 Review. The roles of glucocorticoid receptor isoforms alpha and beta in the response to glucocorticoids in asthma are analyzed.
12208951 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
12145329 The glucocorticoid receptor: coding a diversity of proteins and responses through a single gene. Review.
12114309 There was a significantly higher expression of the GR is untreated RA patients than controls. Glucocorticoid treatment was associated with a strongly decreased GR density.
12099703 Functional interaction between the pro-apoptotic DAP3 and the glucocorticoid receptor
12039077 This study shows that both promoters 1B and 1C are important for the ubiquitous expression of the human glucocorticoid receptor gene.
11996936 AUUUA motifs in the 3'UTR of human glucocorticoid receptor alpha and beta mRNA destabilize mRNA and decrease receptor protein expression
11983486 Glucocorticoid receptor binding in twin pairs is affected by shared environment but not by shared genes
11971959 Results are consistent with a dynamic model in which GR first binds to chromatin after ligand activation, recruits a remodeling activity, facilitates transcription factor binding, and is simultaneously lost from the template.
11932321 Female pseudohermaphroditism caused by a novel homozygous missense mutation of the GR gene.
11873873 Observational study of gene-disease association. (HuGE Navigator)
11711524 Observational study of gene-disease association. (HuGE Navigator)
11710540 The counteracting action of cortisone against cortisol-induced apoptosis may take place partially through intervention of GC-receptors (GC-Rs), but may also be due to unknown pathway(s) different from those mediated by cellular GC-Rs.
11708406 The findings show an association between rheumatoid arthritis and a polymorphism in the hGR gene that increased the stability of hGRbeta mRNA.
11689055 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
11673782 Observational study of gene-disease association. (HuGE Navigator)
11571596 Observational study of gene-disease association. (HuGE Navigator)
11344238 Observational study of gene-disease association. (HuGE Navigator)
11287026 Observational study of gene-disease association. (HuGE Navigator)
11250851 Observational study of gene-disease association. (HuGE Navigator)
11229437 Observational study of gene-disease association. (HuGE Navigator)
11119758 Observational study of gene-disease association. (HuGE Navigator)
10933727 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
10359081 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
9874563 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
9334723 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
8800208 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner
7724608 Glucocorticoid receptor (GR) agonists, dexamethasone (Dex) and medroxyprogesterone acetate (MPA), enhance HIV-1 Vpr peptide (amino acids 52-96)-mediated apoptosis of CD4+ T-cells in a GR-dependent manner

AA Sequence

MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSV      1 - 70
SNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK     71 - 140
SSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNE    141 - 210
SPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEK    211 - 280
EDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI    281 - 350
FNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL    351 - 420
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEA    421 - 490
RKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIM    491 - 560
TTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIIN    561 - 630
EQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKA    631 - 700
IVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIK    701 - 770
KLLFHQK                                                                   771 - 777
//

Text Mined References (865)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26938822 2016 Association of the glucocorticoid receptor gene polymorphisms and their interaction with stressful life events in Polish adolescent girls with anorexia nervosa.
26907965 2016 Role of Pro-637 and Gln-642 in human glucocorticoid receptors and Ser-843 and Leu-848 in mineralocorticoid receptors in their differential responses to cortisol and aldosterone.
26821164 2016 Glucocorticoid Receptor (NR3C1) Variants Associate with the Muscle Strength and Size Response to Resistance Training.
26782558 2015 Glucocorticoid receptor gene (NR3C1) promoter is hypermethylated in Thai females with major depressive disorder.
26745667 2016 Structural Analysis on the Pathologic Mutant Glucocorticoid Receptor Ligand-Binding Domains.
26711253 2015 Human Glucocorticoid Receptor ? Regulates Gluconeogenesis and Inflammation in Mouse Liver.
26647360 2015 HPA AXIS RELATED GENES AND RESPONSE TO PSYCHOLOGICAL THERAPIES: GENETICS AND EPIGENETICS.
26635083 2015 Effects of histamine H1 receptor signaling on glucocorticoid receptor activity. Role of canonical and non-canonical pathways.
26593036 2015 The activity of protein phosphatase 5 towards native clients is modulated by the middle- and C-terminal domains of Hsp90.
26585459 2015 Neurobehavior related to epigenetic differences in preterm infants.
26541474 2016 Functional characterization of the hGR?T556I causing Chrousos syndrome.
26480216 2016 Overexpression of GRß in colonic mucosal cell line partly reflects altered gene expression in colonic mucosa of patients with inflammatory bowel disease.
26408078 2015 Glucocorticoid receptor ChIP-sequencing of subcutaneous fat reveals modulation of inflammatory pathways.
26387521 2015 Early life trauma, depression and the glucocorticoid receptor gene--an epigenetic perspective.
26343289 2015 Placental epigenetic patterning of glucocorticoid response genes is associated with infant neurodevelopment.
26327302 2015 Maternal psychosocial stress during pregnancy alters the epigenetic signature of the glucocorticoid receptor gene promoter in their offspring: a meta-analysis.
26270571 2015 Nuclear bioavailability of the glucocorticoid receptor in a pediatric asthma cohort with variable corticosteroid responsiveness.
26267475 2015 Glucocorticoid Receptor-DNA Dissociation Kinetics Measured in Vitro Reveal Exchange on the Second Time Scale.
26242202 2015 Endothelial glucocorticoid receptor promoter methylation according to dexamethasone sensitivity.
26230484 2015 Chronic Fatigue Syndrome and DNA Hypomethylation of the Glucocorticoid Receptor Gene Promoter 1F Region: Associations With HPA Axis Hypofunction and Childhood Trauma.
26228405 2015 Corticosteroid receptor genes and childhood neglect influence susceptibility to crack/cocaine addiction and response to detoxification treatment.
26186654 2015 Promoter methylation of glucocorticoid receptor gene is associated with subclinical atherosclerosis: A monozygotic twin study.
26183204 2015 Homodimerization of glucocorticoid receptor from single cells investigated using fluorescence correlation spectroscopy and microwells.
26152664 Individual Differences in Childhood Behavior Disorders Associated With Epigenetic Modulation of the Cortisol Receptor Gene.
26139210 2015 BclI glucocorticoid receptor polymorphism in relation to cardiovascular variables: the Hoorn and CODAM studies.
26118026 [BCL1 POLYMORPHISM OF GLUCOCORTICOID RECEPTOR GENE AND RESPIRATORY DISEASES].
26088140 2015 Response Element Composition Governs Correlations between Binding Site Affinity and Transcription in Glucocorticoid Receptor Feed-forward Loops.
26080088 2015 Epigenetic modifications of the glucocorticoid receptor gene are associated with the vulnerability to psychopathology in childhood maltreatment.
26055322 2015 Glucocorticoid Receptor Transcriptional Activation via the BRG1-Dependent Recruitment of TOP2? and Ku70/86.
26032496 2015 Kaposi's sarcoma-associated herpesvirus-encoded LANA associates with glucocorticoid receptor and enhances its transcriptional activities.
26031419 2015 A novel mutation of the hGR gene causing Chrousos syndrome.
25970251 2015 PPAR-? and glucocorticoid receptor synergize to promote erythroid progenitor self-renewal.
25953903 2015 Coupling of Conformational Transitions in the N-terminal Domain of the 51-kDa FK506-binding Protein (FKBP51) Near Its Site of Interaction with the Steroid Receptor Proteins.
25951242 2015 Glucocorticoid receptor gene methylation and HPA-axis regulation in adolescents. The TRAILS study.
25942041 2015 Effects of prenatal and postnatal depression, and maternal stroking, at the glucocorticoid receptor gene.
25938942 2015 NALP3 inflammasome upregulation and CASP1 cleavage of the glucocorticoid receptor cause glucocorticoid resistance in leukemia cells.
25926062 2016 The glucocorticoid receptor A3669G SNP is not associated with polycythemia vera, essential thrombocythemia or primary myelofibrosis.
25899090 2015 Hypermethylation of glucocorticoid receptor gene promoter results in glucocorticoid receptor gene low expression in peripheral blood mononuclear cells of patients with systemic lupus erythematosus.
25889020 2015 Methylation of NR3C1 and SLC6A4 and internalizing problems. The TRAILS study.
25879559 2015 Bcl1 polymorphism of glucocorticoids receptor gene and bronchial asthma.
25875334 2015 Maternal prenatal depressive symptoms predict infant NR3C1 1F and BDNF IV DNA methylation.
25847991 2015 Glucocorticoid receptor regulates accurate chromosome segregation and is associated with malignancy.
25815773 2015 Association of the glucocorticoid receptor D641V variant with steroid-resistant asthma: a case-control study.
25775514 2015 Glucocorticoid receptor interacts with PNRC2 in a ligand-dependent manner to recruit UPF1 for rapid mRNA degradation.
25772595 2015 MicroRNA-9 regulates steroid-resistant airway hyperresponsiveness by reducing protein phosphatase 2A activity.
25771224 2015 Single nucleotide polymorphism creating a variable upstream open reading frame regulates glucocorticoid receptor expression.
25765757 2015 Glucocorticoid and mineralocorticoid receptor polymorphisms and recurrence of major depressive disorder.
25762479 2015 Clinical and biological significance of glucocorticoid receptor (GR) expression in breast cancer.
25748343 2015 Cysteine oxidation impairs systemic glucocorticoid responsiveness in children with difficult-to-treat asthma.
25745955 2015 Identification and characterization of HPA-axis reactivity endophenotypes in a cohort of female PTSD patients.
25724472 2015 Polymorphisms in the glucocorticoid receptor gene and in the glucocorticoid-induced transcript 1 gene are associated with disease activity and response to glucocorticoid bridging therapy in rheumatoid arthritis.
25712143 2015 An abnormality in glucocorticoid receptor expression differentiates steroid responders from nonresponders in keloid disease.
25687413 2016 Effects of the Social Environment and Stress on Glucocorticoid Receptor Gene Methylation: A Systematic Review.
25665148 Expression of glucocorticoid receptor isoforms and associations with serine/arginine-rich protein 30c and 40 in patients with systemic lupus erythematosus.
25649164 2015 The NR3C1 Glucocorticoid Receptor Gene Polymorphisms May Modulate the TGF-beta mRNA Expression in Asthma Patients.
25644744 2015 Single nucleotide polymorphisms in non-coding region of the glucocorticoid receptor gene and prednisone response in childhood acute lymphoblastic leukemia.
25640832 2015 Developmental mediation of genetic variation in response to the Fast Track prevention program.
25601472 2015 Long noncoding RNA GAS5: a novel marker involved in glucocorticoid response.
25518867 2015 Association of suboptimal health status with psychosocial stress, plasma cortisol and mRNA expression of glucocorticoid receptor ?/? in lymphocyte.
25511704 2015 Phosphorylation of glucocorticoid receptor tau1c transactivation domain enhances binding to CREB binding protein (CBP) TAZ2.
25479081 2014 Prenatal exposure to arsenic and cadmium impacts infectious disease-related genes within the glucocorticoid receptor signal transduction pathway.
25459891 2015 Examining the joint contribution of placental NR3C1 and HSD11B2 methylation for infant neurobehavior.
25422592 2014 Distinct, genome-wide, gene-specific selectivity patterns of four glucocorticoid receptor coregulators.
25301232 2015 Glucocorticoid Receptor ? Acts as a Co-activator of T-Cell Factor 4 and Enhances Glioma Cell Proliferation.
25202013 2014 Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner.
25155432 2014 Recent advances in the molecular mechanisms determining tissue sensitivity to glucocorticoids: novel mutations, circadian rhythm and ligand-induced repression of the human glucocorticoid receptor.
25150144 2014 Role of the 5'-untranslated regions in post-transcriptional regulation of the human glucocorticoid receptor.
25138562 2015 The expression of glucocorticoid receptor is negatively regulated by active androgen receptor signaling in prostate tumors.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25113244 2014 The relationship between glucocorticoid receptor polymorphisms, stressful life events, social support, and post-traumatic stress disorder.
25104270 2014 Polymorphisms in NR3C1 gene associated with risk of metabolic syndrome in a Chinese population.
25080589 2014 Epigenetic modification of the glucocorticoid receptor gene is linked to traumatic memory and post-traumatic stress disorder risk in genocide survivors.
25058354 2014 Autocrine positive regulatory feedback of glucocorticoid secretion: glucocorticoid receptor directly impacts H295R human adrenocortical cell function.
25048180 2014 Association between methylation of the glucocorticoid receptor gene, childhood maltreatment, and clinical severity in borderline personality disorder.
25043756 2014 Dihydrotestosterone enhances castration-resistant prostate cancer cell proliferation through STAT5 activation via glucocorticoid receptor pathway.
25023132 2014 Postnatal epigenetic modification of glucocorticoid receptor gene in preterm infants: a prospective cohort study.
25015855 2014 Reduced glucocorticoid receptor expression predicts bladder tumor recurrence and progression.
24949977 2014 Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles.
24946471 [No association of glucocorticoid receptor gene polymorphism (rs6190) with unipolar and bipolar disorder].
24915124 2014 Common genetic variants in the glucocorticoid receptor and the 11?-hydroxysteroid dehydrogenase type 1 genes influence long-term cognitive impairments in patients with Cushing's syndrome in remission.
24895125 2014 Loss of TBL1XR1 disrupts glucocorticoid receptor recruitment to chromatin and results in glucocorticoid resistance in a B-lymphoblastic leukemia model.
24832930 2014 Influences of maternal and paternal PTSD on epigenetic regulation of the glucocorticoid receptor gene in Holocaust survivor offspring.
24816241 2014 Adrenal insufficiency during treatment for childhood acute lymphoblastic leukemia is associated with glucocorticoid receptor polymorphisms ER22/23EK and BclI.
24741566 2014 Genetic variants in the genes of the stress hormone signalling pathway and depressive symptoms during and after pregnancy.
24736075 2014 Glucocorticoid receptor status is a principal determinant of variability in the sensitivity of non-small-cell lung cancer cells to pemetrexed.
24728165 2014 NR3C1 polymorphisms in Brazilians of Caucasian, African, and Asian ancestry: glucocorticoid sensitivity and genotype association.
24702814 2014 Brureau et al. (2013): evidence for inactivation of central glucocorticoid receptors by amyloid-? protein?
24661442 2015 Lower methylation of glucocorticoid receptor gene promoter 1F in peripheral blood of veterans with posttraumatic stress disorder.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24629067 2014 Glucocorticoid receptor repression mediated by BRCA1 inactivation in ovarian cancer.
24626943 2014 Association of glucocorticoid receptor polymorphisms with clinical and metabolic profiles in polycystic ovary syndrome.
24622770 2014 Frequent promoter hypermethylation and expression reduction of the glucocorticoid receptor gene in breast tumors.
24615402 2014 Glucocorticoid receptor activity contributes to resistance to androgen-targeted therapy in prostate cancer.
24602212 2014 Lack of association between glucocorticoid receptor polymorphisms and erythropoiesis.
24559102 2014 A kinase-independent activity of Cdk9 modulates glucocorticoid receptor-mediated gene induction.
24535466 2014 Hypothalamic-pituitary-adrenal axis activity, personality traits, and BCL1 and N363S polymorphisms of the glucocorticoid receptor gene in metabolically obese normal-weight women.
24515279 2014 Glucocorticoid receptor enhances involucrin expression of keratinocyte in a ligand-independent manner.
24500711 2014 Context-dependent cooperation between nuclear factor ?B (NF-?B) and the glucocorticoid receptor at a TNFAIP3 intronic enhancer: a mechanism to maintain negative feedback control of inflammation.
24483153 2014 A novel point mutation of the human glucocorticoid receptor gene causes primary generalized glucocorticoid resistance through impaired interaction with the LXXLL motif of the p160 coactivators: dissociation of the transactivating and transreppressive activities.
24466047 2014 9? Polymorphism of the glucocorticoid receptor gene appears to have limited impact in patients with Addison's disease.
24465557 2014 Association between glucocorticoid receptor methylation and hippocampal subfields in major depressive disorder.
24429396 2014 Genetic and in vivo determinants of glucocorticoid sensitivity in relation to clinical outcome of childhood nephrotic syndrome.
24422633 2014 Bifunctional ligands allow deliberate extrinsic reprogramming of the glucocorticoid receptor.
24418810 2014 Association of glucocorticoid receptor haplotypes with body composition and metabolic parameters in HIV-infected patients from the FRAM study.
24418538 2014 The respiratory syncytial virus (RSV) nonstructural proteins mediate RSV suppression of glucocorticoid receptor transactivation.
24417561 2015 Analyses of Sequence Variants in the MYOC Gene and of Single Nucleotide Polymorphisms in the NR3C1 and FKBP5 Genes in Corticosteroid-Induced Ocular Hypertension.
24399729 2013 Glucocorticoid receptor regulates organic cation transporter 1 (OCT1, SLC22A1) expression via HNF4? upregulation in primary human hepatocytes.
24316275 2014 Profiling of enantiopure drugs towards aryl hydrocarbon (AhR), glucocorticoid (GR) and pregnane X (PXR) receptors in human reporter cell lines.
24291004 2013 Direct reversal of glucocorticoid resistance by AKT inhibition in acute lymphoblastic leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24186266 2014 Altered expression of inflammation-associated genes in oviductal cells following follicular fluid exposure: implications for ovarian carcinogenesis.
24166279 2013 Loss of glucocorticoid receptor activation is a hallmark of BRCA1-mutated breast tissue.
24128430 2014 The therapeutic outcome to intravenous steroid therapy for active Graves' orbitopathy is influenced by the time of response but not polymorphisms of the glucocorticoid receptor.
24097989 2013 A conserved protein motif is required for full modulatory activity of negative elongation factor subunits NELF-A and NELF-B in modifying glucocorticoid receptor-regulated gene induction properties.
24012103 2013 Association between OPCRIT dimensions and polymorphisms of HPA axis genes in bipolar disorder.
23979790 2013 The expression of 11?-HSDs, GR, and H6PDH in subcutaneous adipose tissue from polycystic ovary syndrome subjects.
23963647 2013 Glucocorticoid receptor antagonist and siRNA prevent senescence of human bone marrow mesenchymal stromal cells in vitro.
23892712 2013 Associations between polymorphisms in the glucocorticoid-receptor gene and cardiovascular risk factors in a Chinese population.
23892638 2014 Interaction between occupational stress and GR gene polymorphisms on essential hypertension among railway workers.
23878391 2013 Brain-derived neurotrophic factor signaling rewrites the glucocorticoid transcriptome via glucocorticoid receptor phosphorylation.
23845513 2013 Region-specific alterations in glucocorticoid receptor expression in the postmortem brain of teenage suicide victims.
23823477 2013 Human but not mouse adipogenesis is critically dependent on LMO3.
23820903 2013 Determinants of the heightened activity of glucocorticoid receptor translational isoforms.
23814048 2013 Interaction of glucocorticoid receptor (GR) with estrogen receptor (ER) ? and activator protein 1 (AP1) in dexamethasone-mediated interference of ER? activity.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23778418 2013 Modulatory effect of BclI GR gene polymorphisms on the obesity phenotype in Brazilian patients with Cushing's disease.
23759144 2013 Septic serum induces glucocorticoid resistance and modifies the expression of glucocorticoid isoforms receptors: a prospective cohort study and in vitro experimental assay.
23623868 2013 Nuclear receptors in inflammation control: repression by GR and beyond.
23603102 2013 Glucocorticoids and their receptors: insights into specific roles in mitochondria.
23566423 2013 Investigating the influence of maternal cortisol and emotional state during pregnancy on the DNA methylation status of the glucocorticoid receptor gene (NR3C1) promoter region in cord blood.
23548248 2013 Reduced glucocorticoid receptor protein expression in children with critical illness.
23543128 2013 MR and GR functional SNPs may modulate tobacco smoking susceptibility.
23527567 2014 Lack of association between NR3C1 polymorphism and glucocorticoid resistance in Chinese patients with immune thrombocytopenia.
23523565 2013 Metabolic functions of glucocorticoid receptor in skeletal muscle.
23508108 2013 RSUME enhances glucocorticoid receptor SUMOylation and transcriptional activity.
23506845 2013 Reduced expression of 15-hydroxy prostaglandin dehydrogenase in chorion during labor is associated with decreased PRB and increased PRA and GR expression.
23499945 2013 Complex genomic interactions in the dynamic regulation of transcription by the glucocorticoid receptor.
23449091 2013 Genetic and epigenetic associations of MAOA and NR3C1 with depression and childhood adversities.
23440419 2013 DC-SCRIPT regulates glucocorticoid receptor function and expression of its target GILZ in dendritic cells.
23435844 2013 Low expression of glucocorticoid receptor alpha isoform in adult immune thrombocytopenia correlates with glucocorticoid resistance.
23428870 2013 Ligand-induced repression of the glucocorticoid receptor gene is mediated by an NCoR1 repression complex formed by long-range chromatin interactions with intragenic glucocorticoid response elements.
23426617 2013 A novel point mutation in the DNA-binding domain (DBD) of the human glucocorticoid receptor causes primary generalized glucocorticoid resistance by disrupting the hydrophobic structure of its DBD.
23393177 2013 BclI glucocorticoid receptor polymorphism is associated with greater body fatness: the Hoorn and CODAM studies.
23392094 2013 Exploring the molecular mechanisms of glucocorticoid receptor action from sensitivity to resistance.
23391271 2013 Further characterization of human glucocorticoid receptor mutants, R477H and G679S, associated with primary generalized glucocorticoid resistance.
23355259 2013 The glucocorticoid receptor gene polymorphism N363S predisposes to more severe toxic side effects during pediatric acute lymphoblastic leukemia (ALL) therapy.
23339905 2013 Membrane glucocorticoid receptor activation induces proteomic changes aligning with classical glucocorticoid effects.
23334186 2013 Impaired nuclear translocation of glucocorticoid receptors: novel findings from psoriatic epidermal keratinocytes.
23329746 2013 Glucocorticoid receptor expression in whole blood with preterm infants.
23325854 2013 Nucleosome mapping across the CFTR locus identifies novel regulatory factors.
23307810 2013 Incoherent feed-forward regulatory logic underpinning glucocorticoid receptor action.
23303127 2013 Selective glucocorticoid receptor translational isoforms reveal glucocorticoid-induced apoptotic transcriptomes.
23297131 2013 Glucocorticoid receptor translational isoforms underlie maturational stage-specific glucocorticoid sensitivities of dendritic cells in mice and humans.
23290588 2013 Glucocorticoid receptor protein expression in human hippocampus; stability with age.
23267834 2013 How glucocorticoid receptors modulate the activity of other transcription factors: a scope beyond tethering.
23239757 2013 Investigation of glucocorticoid receptor polymorphisms in relation to metabolic parameters in Addison's disease.
23239753 2013 Glucocorticoid receptor signaling contributes to constitutive activation of the noncanonical NF-?B pathway in term human placenta.
23228967 2013 FBXW7 regulates glucocorticoid response in T-cell acute lymphoblastic leukaemia by targeting the glucocorticoid receptor for degradation.
23222642 2013 The structural basis of direct glucocorticoid-mediated transrepression.
23219223 2013 Gene and protein alterations of FKBP5 and glucocorticoid receptor in the amygdala of suicide victims.
23212335 2012 Tissue-specific adaptive levels of glucocorticoid receptor alpha mRNA and their relationship with insulin resistance.
23209664 2012 Progesterone acts via the nuclear glucocorticoid receptor to suppress IL-1?-induced COX-2 expression in human term myometrial cells.
23204024 2012 No associations of the mineralocorticoid and glucocorticoid receptor genes with asthma.
23196783 2013 Glucocorticoid receptor and molecular chaperones in the pathogenesis of adrenal incidentalomas: potential role of reduced sensitivity to glucocorticoids.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178279 2013 Glucocorticoid receptor concentration and the ability to dimerize influence nuclear translocation and distribution.
23176645 2013 Glucocorticoid receptor BclI polymorphism associates with immunomodulatory response to stress hormone in human peripheral blood mononuclear cells.
23151527 2013 Association of glucocorticoid receptor gene NR3C1 genetic variants with angiographically documented coronary artery disease and its risk factors.
23148886 2013 The BclI polymorphism of the glucocorticoid receptor gene is associated with emotional memory performance in healthy individuals.
23137715 2013 Aberrant stress hormone receptor balance in the human prefrontal cortex and hypothalamic paraventricular nucleus of depressed patients.
23132854 2012 Binding of the N-terminal region of coactivator TIF2 to the intrinsically disordered AF1 domain of the glucocorticoid receptor is accompanied by conformational reorganizations.
23127816 2013 It takes two to tango: dimerisation of glucocorticoid receptor and its anti-inflammatory functions.
23125313 2012 Involvement of GR and p300 in the induction of H6PD by cortisol in human amnion fibroblasts.
23124618 2013 Expression of the cysteinyl leukotriene 1 receptor and glucocorticoid receptor-? in nasal polyps.
23123359 2013 Phosphorylation of leukocyte glucocorticoid receptor in patients with current episode of major depressive disorder.
23073785 2013 Single nucleotide polymorphisms of NR3C1 gene and recurrent depressive disorder in population of Poland.
23072594 2013 Nestin and vimentin colocalization affects the subcellular location of glucocorticoid receptor in cutaneous melanoma.
23068076 2013 No association between polymorphisms and haplotypes of the AVPR1b, CRHR1 and NR3C1 genes and depression with melancholic features in the course of bipolar disorder.
23055525 2012 Identification of location and kinetically defined mechanism of cofactors and reporter genes in the cascade of steroid-regulated transactivation.
23055001 2013 Genetic evidence for the association of the hypothalamic-pituitary-adrenal (HPA) axis with ADHD and methylphenidate treatment response.
23046934 2012 [Expressions of OB-R, IRF-1 and GR-? in airway smooth muscle cells of obese rats with asthma].
23033539 2012 Primary generalized glucocorticoid resistance and hypersensitivity: the end-organ involvement in the stress response.
23033538 2012 Circadian rhythms of glucocorticoid hormone actions in target tissues: potential clinical implications.
23028665 2012 Impact of glucocorticoid receptor gene polymorphisms on the metabolic profile of adult patients with the classical form of 21-hydroxylase deficiency.
22922069 2012 ABC drug transporter and nuclear receptor expression in human cytotrophoblasts: influence of spontaneous syncytialization and induction by glucocorticoids.
22889053 2012 Glucocorticoid receptor gene polymorphisms and disease activity during pregnancy and the postpartum period in rheumatoid arthritis.
22879541 2012 A3669G polymorphism of glucocorticoid receptor is a susceptibility allele for primary myelofibrosis and contributes to phenotypic diversity and blast transformation.
22855579 2012 Thalidomide in total therapy 2 overcomes inferior prognosis of myeloma with low expression of the glucocorticoid receptor gene NR3C1.
22851186 2012 Glucocorticoid receptor density correlates with health risk factors and insulin resistance in Caucasian and African American subjects.
22848740 2012 FOXO3 is a glucocorticoid receptor target and regulates LKB1 and its own expression based on cellular AMP levels via a positive autoregulatory loop.
22846929 2013 Glucocorticoid sensitivity of T-cell lymphoblastic leukemia/lymphoma is associated with glucocorticoid receptor-mediated inhibition of Notch1 expression.
22832351 2011 Increased methylation of glucocorticoid receptor gene (NR3C1) in adults with a history of childhood maltreatment: a link with the severity and type of trauma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22812453 2012 Glucocorticoid receptor mRNA and protein isoform alterations in the orbitofrontal cortex in schizophrenia and bipolar disorder.
22810058 2012 Methylation changes at NR3C1 in newborns associate with maternal prenatal stress exposure and newborn birth weight.
22801563 Prevalence and cardiometabolic associations of the glucocorticoid receptor gene polymorphisms N363S and BclI in obese and non-obese black and white Mississippians.
22798432 2012 Glucocorticoid receptor and histone deacetylase-2 mediate dexamethasone-induced repression of MUC5AC gene expression.
22781842 2012 Variation in the glucocorticoid receptor gene at rs41423247 moderates the effect of prenatal maternal psychological symptoms on child cortisol reactivity and behavior.
22773829 2012 Glucocorticoid receptor activation inhibits p53-induced apoptosis of MCF10Amyc cells via induction of protein kinase C?.
22771494 2012 Glycogen synthase kinase-3? is involved in ligand-dependent activation of transcription and cellular localization of the glucocorticoid receptor.
22728713 2012 NR3C1 gene polymorphism for genetic susceptibility to infantile spasms in a Chinese population.
22714792 2013 Genetic and epigenetic variation of the glucocorticoid receptor (NR3C1) in placenta and infant neurobehavior.
22698871 2012 Glucocorticoid receptor-DNA interactions: binding energetics are the primary determinant of sequence-specific transcriptional activity.
22592921 2012 Cytokines alter glucocorticoid receptor phosphorylation in airway cells: role of phosphatases.
22587831 2012 BClI polymorphism of the glucocorticoid receptor gene is associated with increased obesity, impaired glucose metabolism and dyslipidaemia in patients with Addison's disease.
22587663 2012 Glucocorticoid receptor-promoter interactions: energetic dissection suggests a framework for the specificity of steroid receptor-mediated gene regulation.
22576823 2012 Associations of glucocorticoid receptor and corticosteroid-binding globulin gene polymorphisms on fat mass and fat mass distribution in prepubertal obese children.
22570980 2012 Lack of mutations in the gene coding for the hGR (NR3C1) in a pediatric patient with ACTH-secreting pituitary adenoma, absence of stigmata of Cushing's syndrome and unusual histologic features.
22533504 2012 The expression of the glucocorticoid receptor in human erythroblasts is uniquely regulated by KIT ligand: implications for stress erythropoiesis.
22516993 2012 [Role of glucocorticoid receptor in the pathogenesis of systemic lupus erythematosus].
22516378 2012 c-Myb interacts with the glucocorticoid receptor and regulates its level in pre-B-acute lymphoblastic leukemia cells.
22507373 2012 Glucocorticoid receptor gene polymorphisms are associated with reduced first-phase glucose-stimulated insulin secretion and disposition index in women, but not in men.
22487832 2012 [Association between plasma lipid, glucose, cortisol and adrenocorticotropic hormone levels and GR and ACTHR gene polymorphisms].
22469783 2012 The N363S and I559N single nucleotide polymorphisms of the h-GR/NR3C1 gene in patients with bronchial asthma.
22444201 2012 Differential glucocorticoid receptor exon 1(B), 1(C), and 1(H) expression and methylation in suicide completers with a history of childhood abuse.
22441538 2012 Variability in laboratory immune parameters is associated with stress hormone receptor polymorphisms.
22427805 2012 Glucocorticoid receptor 1B and 1C mRNA transcript alterations in schizophrenia and bipolar disorder, and their possible regulation by GR gene variants.
22425674 2012 Chromatin remodeling during glucocorticoid receptor regulated transactivation.
22410078 2012 Brain activation during fear conditioning in humans depends on genetic variations related to functioning of the hypothalamic-pituitary-adrenal axis: first evidence from two independent subsamples.
22371499 2012 O-GlcNAc transferase is involved in glucocorticoid receptor-mediated transrepression.
22366879 2012 Association study between glucocorticoid receptor gene polymorphisms and personality traits in healthy Japanese individuals.
22357529 2011 [Associations of GR and ACTHR gene polymorphisms with quantitative trait of strain].
22295073 2012 Childhood adversity and epigenetic modulation of the leukocyte glucocorticoid receptor: preliminary findings in healthy adults.
22227972 2012 Bayesian image analysis of dexamethasone and shear stress-induced glucocorticoid receptor intracellular movement.
22205602 2012 Spliceosome protein (SRp) regulation of glucocorticoid receptor isoforms and glucocorticoid response in human trabecular meshwork cells.
22185489 2012 NF?B and glucocorticoid receptor activity in steroid resistance.
22177699 2012 NRIP enhances HPV gene expression via interaction with either GR or E2.
22174376 2012 Complex human glucocorticoid receptor dim mutations define glucocorticoid induced apoptotic resistance in bone cells.
22170608 2011 Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.
22088926 2012 Interaction of the BcII glucocorticoid receptor polymorphism and childhood abuse in Bulimia Nervosa (BN): relationship to BN and to associated trait manifestations.
22085474 Evidence for the involvement of the glucocorticoid receptor gene in bipolar disorder in an isolated northern Swedish population.
22083731 2013 Genetic modulation of neural response during working memory in healthy individuals: interaction of glucocorticoid receptor and dopaminergic genes.
22068557 2011 Hypothalamic-pituitary-adrenocortical axis hypersensitivity and glucocorticoid receptor expression and function in women with polycystic ovary syndrome.
22048965 2012 Association of glucocorticoid receptor polymorphism A3669G with decreased risk of developing diabetes in patients with Cushing's syndrome.
22032841 2012 Reduced glucocorticoid receptor expression and function in airway neutrophils.
22022502 2011 An interaction network predicted from public data as a discovery tool: application to the Hsp90 molecular chaperone machine.
22018181 Glucocorticoid receptor: implications for rheumatic diseases.
22015776 2012 The role of functional single nucleotide polymorphisms of the human glucocorticoid receptor gene NR3C1 in Polish patients with bronchial asthma.
22008062 2012 Association between BclI polymorphism in the NR3C1 gene and in vitro individual variations in lymphocyte responses to methylprednisolone.
22003412 2011 Binding-folding induced regulation of AF1 transactivation domain of the glucocorticoid receptor by a cofactor that binds to its DNA binding domain.
21995950 2012 Regulation of mRNA expression encoding chaperone and co-chaperone proteins of the glucocorticoid receptor in peripheral blood: association with depressive symptoms during pregnancy.
21984896 2011 Loss of glucocorticoid receptor expression by DNA methylation prevents glucocorticoid induced apoptosis in human small cell lung cancer cells.
21980503 2011 Peripheral CLOCK regulates target-tissue glucocorticoid receptor transcriptional activity in a circadian fashion in man.
21971518 2012 Glucocorticoid receptors in human epicardial adipose tissue: role of coronary status.
21945289 2012 Hippocampal GR expression is increased in elderly depressed females.
21930780 2011 Ligand-independent phosphorylation of the glucocorticoid receptor integrates cellular stress pathways with nuclear receptor signaling.
21912096 2011 Primary generalized glucocorticoid resistance and hypersensitivity.
21883217 2011 Dexamethasone-induced up-regulation of the human norepinephrine transporter involves the glucocorticoid receptor and increased binding of C/EBP-? to the proximal promoter of norepinephrine transporter.
21881570 2011 Abnormal glucocorticoid receptor mRNA and protein isoform expression in the prefrontal cortex in psychiatric illness.
21868756 2011 Activation of the glucocorticoid receptor is associated with poor prognosis in estrogen receptor-negative breast cancer.
21853119 2011 Influenza virus infection induces the nuclear relocalization of the Hsp90 co-chaperone p23 and inhibits the glucocorticoid receptor response.
21803757 2011 Genetic polymorphisms of the glucocorticoid receptor may affect the phenotype of women with anovulatory polycystic ovary syndrome.
21789663 2012 Maternal depression and child and adolescent depression symptoms: an exploratory test for moderation by CRHR1, FKBP5 and NR3C1 gene variants.
21788965 2012 Glucocorticoid resistance in Crohn's disease and ulcerative colitis: an association study investigating GR and FKBP5 gene polymorphisms.
21764460 2011 Glucocorticoid receptor polymorphism is associated with major depression and predominance of depression in the course of bipolar disorder.
21760925 2011 TBP binding-induced folding of the glucocorticoid receptor AF1 domain facilitates its interaction with steroid receptor coactivator-1.
21750107 2011 Coactivation of GR and NFKB alters the repertoire of their binding sites and target genes.
21742609 The glucocorticoid receptor and its expression in the anterior pituitary and the adrenal cortex: a source of variation in hypothalamic-pituitary-adrenal axis function; implications for pituitary and adrenal tumors.
21730050 2011 The 90-kDa heat-shock protein (Hsp90)-binding immunophilin FKBP51 is a mitochondrial protein that translocates to the nucleus to protect cells against oxidative stress.
21701417 2011 Novel hyperactive glucocorticoid receptor isoform identified within a human population.
21664385 2011 Glucocorticoids induce mitochondrial gene transcription in HepG2 cells: role of the mitochondrial glucocorticoid receptor.
21646426 2011 The glucocorticoid receptor and the coregulator Brm selectively modulate each other's occupancy and activity in a gene-specific manner.
21641918 Differential nuclear localisation and promoter occupancy play a role in glucocorticoid receptor ligand-specific transcriptional responses.
21633323 2011 Variation in the glucocorticoid receptor gene (NR3C1) may be associated with corticosteroid dependency and resistance in children with Crohn's disease.
21531081 2011 Glucocorticoid and mineralocorticoid receptor polymorphisms and clinical characteristics in bipolar disorder patients.
21527497 2011 Glucocorticoid receptor alpha isoform-selective regulation of antiapoptotic genes in osteosarcoma cells: a new mechanism for glucocorticoid resistance.
21521940 2011 Birthweight is associated with DNA promoter methylation of the glucocorticoid receptor in human placenta.
21521257 2011 Associations between anthropometrical measurements, body composition, single-nucleotide polymorphisms of the hypothalamus/pituitary/adrenal (HPA) axis and HPA axis functioning.
21511880 2011 The HSP90 molecular chaperone cycle regulates cyclical transcriptional dynamics of the glucocorticoid receptor and its coregulatory molecules CBP/p300 during ultradian ligand treatment.
21477816 2011 Glucocorticoid receptor gene haplotype predicts increased risk of hospital admission for depressive disorders in the Helsinki birth cohort study.
21474440 2011 Glucocorticoid-independent repression of tumor necrosis factor (TNF) alpha-stimulated interleukin (IL)-6 expression by the glucocorticoid receptor: a potential mechanism for protection against an excessive inflammatory response.
21473041 2010 [The analysis of the factors influencing the development of glucocorticoid resistance in the etiopathogenesis of severe bronchial asthma].
21438768 2011 Effects of chronic academic stress on mental state and expression of glucocorticoid receptor ? and ? isoforms in healthy Japanese medical students.
21438141 2011 Glucocorticoid receptor haplotype is associated with a decreased risk of delirium in the elderly.
21362280 2011 Generalized glucocorticoid resistance accompanied with an adrenocortical adenoma and caused by a novel point mutation of human glucocorticoid receptor gene.
21355091 2011 The dominant negative ? isoform of the glucocorticoid receptor is uniquely expressed in erythroid cells expanded from polycythemia vera patients.
21354648 2011 Glucocorticoid receptor is indispensable for physiological responses to aldosterone in epithelial Na+ channel induction via the mineralocorticoid receptor in a human colonic cell line.
21269460 2011 Initial characterization of the human central proteome.
21234764 2011 Transcriptional control of the human glucocorticoid receptor: identification and analysis of alternative promoter regions.
21190962 2011 Respiratory syncytial virus represses glucocorticoid receptor-mediated gene activation.
21169818 2011 Relationship of a common polymorphism of the glucocorticoid receptor gene to traumatic memories and posttraumatic stress disorder in patients after intensive care therapy.
21164266 2011 Glucocorticoid resistance.
21148795 2011 The human glucocorticoid receptor as an RNA-binding protein: global analysis of glucocorticoid receptor-associated transcripts and identification of a target RNA motif.
21147850 2011 Regulation of glucocorticoid receptor activity by a stress responsive transcriptional cofactor.
21146942 2011 Glucocorticoid receptor-9beta polymorphism is associated with systolic blood pressure and heart growth during early childhood. The Generation R Study.
21127044 2011 Differential glucocorticoid receptor-mediated transcription mechanisms.
21113676 2011 The Bcl I single nucleotide polymorphism of the human glucocorticoid receptor gene h-GR/NR3C1 promoter in patients with bronchial asthma: pilot study.
21093928 2011 Contributions of the glucocorticoid receptor polymorphism (Bcl1) and childhood abuse to risk of bulimia nervosa.
21084380 2011 A new, lineage specific, autoup-regulation mechanism for human glucocorticoid receptor gene expression in 697 pre-B-acute lymphoblastic leukemia cells.
21078539 2011 Glucocorticoid receptor signaling and prostate cancer.
21050724 2011 Clock genes and body composition in patients with schizophrenia under treatment with antipsychotic drugs.
20885351 2010 Frequencies of Bcl I, E22E, and N363S of h-GR/NR3C1 restriction fragment length polymorphisms of glucocorticoid receptor gene in Polish adult population.
20861124 2010 Familial glucocorticoid resistance caused by a novel frameshift glucocorticoid receptor mutation.
20855522 2011 Ginsenoside-Rg1 induces angiogenesis via non-genomic crosstalk of glucocorticoid receptor and fibroblast growth factor receptor-1.
20850457 2010 Enhancing the stability and solubility of the glucocorticoid receptor ligand-binding domain by high-throughput library screening.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20841450 2010 Glucocorticoid receptor gene haplotypes are not associated with birth anthropometry, blood pressure, glucose and insulin concentrations, and body composition in subjects born small for gestational age.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20733583 2011 Associations of markers in 11 obesity candidate genes with maximal weight loss and weight regain in the SOS bariatric surgery cases.
20731635 2011 Glucocorticoid receptor (NR3C1) gene polymorphisms and onset of alcohol abuse in adolescents.
20727199 2010 Polymorphisms in the glucocorticoid receptor gene that modulate glucocorticoid sensitivity are associated with rheumatoid arthritis.
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20712049 2010 Glucocorticoid receptor gene haplotype structure and steroid therapy outcome in IBD patients.
20697295 2011 Genetic predictors of glucocorticoid response in pediatric patients with inflammatory bowel diseases.
20680430 2011 No associations between single nucleotide polymorphisms in corticoid receptor genes and heart rate and cortisol responses to a standardized social stress test in adolescents: the TRAILS study.
20661446 2010 Differential impact of tetratricopeptide repeat proteins on the steroid hormone receptors.
20660302 2010 AMPK regulates metabolic actions of glucocorticoids by phosphorylating the glucocorticoid receptor through p38 MAPK.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619282 2010 Lysine 419 targets human glucocorticoid receptor for proteasomal degradation.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20584071 2010 Role of glucocorticoid receptor polymorphism in adrenal incidentalomas.
20561560 2010 Role of ligand-dependent GR phosphorylation and half-life in determination of ligand-specific transcriptional activity.
20547006 2010 FKBP5 and resistant attachment predict cortisol reactivity in infants: gene-environment interaction.
20545708 2010 Induction of glucocorticoid receptor-beta expression in epithelial cells of asthmatic airways by T-helper type 17 cytokines.
20543003 2010 AP-1 overexpression impairs corticosteroid inhibition of collagen production by fibroblasts isolated from asthmatic subjects.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20488636 2010 Expression and distribution of glucocorticoid receptor isoforms in eosinophilic chronic rhinosinusitis.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20484466 2010 Glucocorticoid receptor-beta and receptor-gamma exert dominant negative effect on gene repression but not on gene induction.
20472303 2010 Associations between common arginine vasopressin 1b receptor and glucocorticoid receptor gene variants and HPA axis responses to psychosocial stress in a child psychiatric population.
20450542 2010 [Role of glucocorticoid receptor and nuclear factor-kappaB in patients with stable chronic obstructive pulmonary disease].
20448266 Comparative effects of microtubules disruption on glucocorticoid receptor functions in proliferating and quiescent cells.
20440229 2010 Glucocorticoid receptor gene polymorphisms in Italian patients with eating disorders and obesity.
20438742 2010 Expression of glucocorticoid receptor isoforms in human adrenocortical adenomas.
20419394 2011 Glucocorticoid receptor auto-upregulation and its relation with glucocorticoid sensitivity in idiopathic nephrotic syndrome.
20403506 2010 Genetic variation in neuroendocrine genes associates with somatic symptoms in the general population: results from the EPIFUND study.
20399565 2011 The glucocorticoid receptor: pivot of depression and of antidepressant treatment?
20376328 2010 Assessment of SNPs associated with the human glucocorticoid receptor in primary open-angle glaucoma and steroid responders.
20371666 2010 Glucocorticoid receptor gene, low-grade inflammation, and heart failure: the Heart and Soul study.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20335448 2010 A novel point mutation in helix 10 of the human glucocorticoid receptor causes generalized glucocorticoid resistance by disrupting the structure of the ligand-binding domain.
20308989 2011 Dynamic molecular and anatomical changes in the glucocorticoid receptor in human cortical development.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20199670 2010 Glucocorticoid receptor gene polymorphisms do not affect growth in fetal and early postnatal life. The Generation R Study.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
20170710 2010 Glucocorticoid receptor knock down reveals a similar apoptotic threshold but differing gene regulation patterns in T-cell and pre-B-cell acute lymphoblastic leukemia.
20156759 2009 Glucocorticoid receptor gene polymorphisms and potential association to chronic obstructive pulmonary disease susceptibility and severity.
20156337 2010 The role of glucocorticoid receptor phosphorylation in Mcl-1 and NOXA gene expression.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20137628 2009 [Association of glucocorticoid receptor gene polymorphism with myasthenia gravis].
20124551 2010 Noncoding RNA gas5 is a growth arrest- and starvation-associated repressor of the glucocorticoid receptor.
20093418 2010 Glucocorticoid receptor activates poised FKBP51 locus through long-distance interactions.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20036846 2010 Importance of glucocorticoid receptors in upper and lower airways.
20035271 2009 A new link between steroid resistance, glucocorticoid receptor and nuclear factor kappa B p65 in idiopathic nephrotic syndrome.
20032106 2010 Negative relationship between expression of glucocorticoid receptor alpha and disease activity: glucocorticoid treatment of patients with systemic lupus erythematosus.
20018896 2010 Recruitment of cAMP-response element-binding protein and histone deacetylase has opposite effects on glucocorticoid receptor gene transcription.
20015871 2010 Pharmacogenetic risk factors for altered bone mineral density and body composition in pediatric acute lymphoblastic leukemia.
20015838 2010 Glucocorticoid receptor over-expression promotes human small cell lung cancer apoptosis in vivo and thereby slows tumor growth.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19940520 2010 Working memory performance is associated with common glucocorticoid receptor gene polymorphisms.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19913032 2010 Molecular switch in the glucocorticoid receptor: active and passive antagonist conformations.
19875955 2010 Estrogen receptor, progesterone receptor, and glucocorticoid receptor expression in normal breast tissue, breast in situ carcinoma, and invasive breast cancer.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19841061 2010 Site-specific phosphorylation induces functionally active conformation in the intrinsically disordered N-terminal activation function (AF1) domain of the glucocorticoid receptor.
19818358 2010 The human glucocorticoid receptor: molecular basis of biologic function.
19805480 2010 Glucocorticoid receptor interacting protein-1 restores glucocorticoid responsiveness in steroid-resistant airway structural cells.
19801529 2009 Genomic determination of the glucocorticoid response reveals unexpected mechanisms of gene regulation.
19797430 2009 Paradoxical stimulation of cyclooxygenase-2 expression by glucocorticoids via a cyclic AMP response element in human amnion fibroblasts.
19783104 2009 Glucocorticoid receptor gene and depression in patients with coronary heart disease: the Heart and Soul Study-2009 Curt Richter Award Winner.
19782477 2010 Differential expression of glucocorticoid receptor transcripts in major depressive disorder is not epigenetically programmed.
19779205 2009 A novel isoform of human LZIP negatively regulates the transactivation of the glucocorticoid receptor.
19778524 2009 ATP hydrolysis is essential for Bag-1M-mediated inhibition of the DNA binding by the glucocorticoid receptor.
19758697 2010 Polymorphisms in glucocorticoid receptor gene and the outcome of childhood acute lymphoblastic leukemia (ALL).
19723618 2010 Genetic variation in the hypothalamic-pituitary-adrenal stress axis influences susceptibility to musculoskeletal pain: results from the EPIFUND study.
19691529 2009 Effect of glucocorticoid receptor gene polymorphisms in Guillain-Barré syndrome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19683543 Effect of resistance exercise on muscle steroid receptor protein content in strength-trained men and women.
19673019 2009 IL-10 and TNF-alpha promoter haplotypes are associated with childhood Crohn's disease location.
19646928 2009 The relationship between the expression of the glucocorticoid receptor in biopsied colonic mucosa and the glucocorticoid responsiveness of ulcerative colitis patients.
19633971 2009 Human glucocorticoid receptor isoform beta: recent understanding of its potential implications in physiology and pathophysiology.
19628874 2009 Angiopoietin-like 4 (ANGPTL4, fasting-induced adipose factor) is a direct glucocorticoid receptor target and participates in glucocorticoid-regulated triglyceride metabolism.
19621425 2009 Response to glucocorticoids and toxicity in childhood acute lymphoblastic leukemia: role of polymorphisms of genes involved in glucocorticoid response.
19605973 2009 Glucocorticoid receptor mRNA expression in peripheral blood mononuclear cells in high trained compared to low trained athletes and untrained subjects.
19595997 2009 Bag-1M inhibits the transactivation of the glucocorticoid receptor via recruitment of corepressors.
19586900 2009 Estrogen inhibits glucocorticoid action via protein phosphatase 5 (PP5)-mediated glucocorticoid receptor dephosphorylation.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19570036 2009 Interaction of mitochondrial thioredoxin with glucocorticoid receptor and NF-kappaB modulates glucocorticoid receptor and NF-kappaB signalling in HEK-293 cells.
19564704 2009 Comparison of gene transcription between subcutaneous and visceral adipose tissue in Chinese adults.
19562035 2009 Nestin modulates glucocorticoid receptor function by cytoplasmic anchoring.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19545546 2009 Modulation of glucocorticoid receptor nuclear translocation in neurons by immunophilins FKBP51 and FKBP52: implications for major depressive disorder.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19484926 2009 [Expression of glucocorticoid receptors alpha and beta in mononuclear cells of peripheral blood in patients with glucocorticoid-induced ocular hypertension].
19466222 2009 The N363S polymorphism in the glucocorticoid receptor gene: effects on visceral fat assessed by abdominal computed tomography.
19463884 2009 Crosstalk between activated forms of the aryl hydrocarbon receptor and glucocorticoid receptor.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19450611 2009 Hypoxia down-regulates glucocorticoid receptor alpha and attenuates the anti-inflammatory actions of dexamethasone in human alveolar epithelial A549 cells.
19450127 2009 Asthma pharmacogenetic study using finite mixture models to handle drug-response heterogeneity.
19435830 2009 Human glucocorticoid receptor alpha gene (NR3C1) pharmacogenomics: gene resequencing and functional genomics.
19429432 2009 High resolution melting (HRM) analysis for the detection of ER22/23EK, BclI, and N363S polymorphisms of the glucocorticoid receptor gene.
19413563 2009 BclI glucocorticoid receptor polymorphism and smoking in the general population.
19375647 2009 Interaction between the glucocorticoid and erythropoietin receptors in human erythroid cells.
19373457 2009 Glucocorticoid receptor mRNA levels are selectively decreased in neutrophils of children with sepsis.
19372434 2009 DNA binding site sequence directs glucocorticoid receptor structure and activity.
19365399 2009 Genetic predictors of response to antidepressants in the GENDEP project.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19336230 2009 Overrepresentation of BclI polymorphism of the glucocorticoid receptor gene in pregnant women with HELLP syndrome.
19318444 2009 A glucocorticoid receptor gene haplotype (TthIII1/ER22/23EK/9beta) is associated with a more aggressive disease course in multiple sclerosis.
19282465 2009 Glucocorticoid replacement therapy and pharmacogenetics in Addison's disease: effects on bone.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19248771 2009 Glucocorticoid receptor (GR) beta has intrinsic, GRalpha-independent transcriptional activity.
19241242 2009 The protective effect of the ER22/23EK polymorphism against an excessive weight gain during pregnancy.
19234457 2009 Epigenetic regulation of the glucocorticoid receptor in human brain associates with childhood abuse.
19234455 2009 Stress and addiction: glucocorticoid receptor in dopaminoceptive neurons facilitates cocaine seeking.
19230884 2009 Distributions of glucocorticoid receptor gene polymorphisms in a Chinese Han population and associations with outcome after major trauma.
19222494 2009 Glucocorticoid receptor gene variant is associated with increased body fatness in youngsters.
19207316 2009 BclI polymorphism of the glucocorticoid receptor gene is associated with decreased bone mineral density in patients with endogenous hypercortisolism.
19188741 2009 Glucocorticoid receptor gene polymorphism is less frequent in children born small for gestational age without catch-up growth.
19183974 2009 Glutathione-S-transferase-P1 I105V polymorphism and response to antenatal betamethasone in the prevention of respiratory distress syndrome.
19177170 2009 Timing is critical for effective glucocorticoid receptor mediated repression of the cAMP-induced CRH gene.
19174530 2009 Functional glucocorticoid receptor gene variants do not underlie the high variability of 17-hydroxyprogesterone screening values in healthy newborns.
19146914 2009 Glucocorticoid receptor plays an indispensable role in mineralocorticoid receptor-dependent transcription in GR-deficient BE(2)C and T84 cells in vitro.
19141540 2009 Circadian rhythm transcription factor CLOCK regulates the transcriptional activity of the glucocorticoid receptor by acetylating its hinge region lysine cluster: potential physiological implications.
19133972 2009 Functional polymorphism of the glucocorticoid receptor gene associates with mania and hypomania in bipolar disorder.
19100874 2009 Calreticulin mediated glucocorticoid receptor export is involved in beta-catenin translocation and Wnt signalling inhibition in human osteoblastic cells.
19095219 2009 Variation in catechol-O-methyltransferase is associated with duloxetine response in a clinical trial for major depressive disorder.
19089807 2009 Mutation screen and association analysis of the glucocorticoid receptor gene (NR3C1) in childhood-onset mood disorders (COMD).
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19074285 2008 GRIP1-associated SET-domain methyltransferase in glucocorticoid receptor target gene expression.
19051288 2009 Glucocorticoid receptor gene polymorphisms and childhood adversity are associated with depression: New evidence for a gene-environment interaction.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19008334 2009 A RAS recruitment screen identifies ZKSCAN4 as a glucocorticoid receptor-interacting protein.
19007849 2009 Long-term low level glucocorticoid exposure induces persistent repression in chromatin.
19007848 2009 Ligand-selective transactivation and transrepression via the glucocorticoid receptor: role of cofactor interaction.
19005987 2008 Glucocorticoid receptor polymorphisms and intraocular pressure response to intravitreal triamcinolone acetonide.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18983327 2008 A 5-year follow-up study of 3 polymorphisms in the human glucocorticoid receptor gene in relation to obesity, hypertension, and diabetes.
18958157 2008 Dibutyltin disrupts glucocorticoid receptor function and impairs glucocorticoid-induced suppression of cytokine production.
18952539 2008 No association of glucocorticoid receptor polymorphisms with asthma and response to glucocorticoids.
18945813 2008 A conserved molecular mechanism is responsible for the auto-up-regulation of glucocorticoid receptor gene promoters.
18854398 2009 Glucocorticoid receptor gene variant in the 3' untranslated region is associated with multiple measures of blood pressure.
18838540 2008 Glycogen synthase kinase 3beta-mediated serine phosphorylation of the human glucocorticoid receptor redirects gene expression profiles.
18838498 2010 Association of HPA axis genes with suicidal behaviour in schizophrenia.
18830906 Glucocorticoid receptor variants may predispose to rheumatoid arthritis susceptibility.
18827003 2008 A novel point mutation in the amino terminal domain of the human glucocorticoid receptor (hGR) gene enhancing hGR-mediated gene expression.
18822299 2008 Bag-1M is a component of the in vivo DNA-glucocorticoid receptor complex at hormone-regulated promoter.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18812484 2008 Two common haplotypes of the glucocorticoid receptor gene are associated with increased susceptibility to cardiovascular disease in men with familial hypercholesterolemia.
18801933 2008 Tissue- and context-dependent modulation of hormonal sensitivity of glucocorticoid-responsive genes by hexamethylene bisacetamide-inducible protein 1.
18789525 2009 Receptor mutation is not a common mechanism of naturally occurring glucocorticoid resistance in leukaemia cell lines.
18772142 2008 Glucocorticoid receptor-mediated expression of caldesmon regulates cell migration via the reorganization of the actin cytoskeleton.
18728163 2008 Expression of glucocorticoid receptor messenger ribonucleic acid transcripts in the human placenta at term.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18668364 2009 Glucocorticoid receptor expression in breast cancer associates with older patient age.
18663733 2009 Characterization of a glucocorticoid receptor gene (GR, NR3C1) promoter polymorphism reveals functionality and extends a haplotype with putative clinical relevance.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18595687 2008 Association between birth weight in preterm neonates and the BclI polymorphism of the glucocorticoid receptor gene.
18583474 2008 Identification and functional analysis of SKA2 interaction with the glucocorticoid receptor.
18536531 Prenatal exposure to maternal depression, neonatal methylation of human glucocorticoid receptor gene (NR3C1) and infant cortisol stress responses.
18515658 2008 Dexamethasone-induced apoptotic mechanisms in myeloma cells investigated by analysis of mutant glucocorticoid receptors.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18502562 2008 Glucocorticoid receptor gene polymorphisms and glucocorticoid sensitivity of subdermal blood vessels and leukocytes.
18483179 2008 Glucocorticoid receptor phosphorylation differentially affects target gene expression.
18468809 2008 Glucocorticoid sensitivity in fibromyalgia patients: decreased expression of corticosteroid receptors and glucocorticoid-induced leucine zipper.
18417736 2008 DAX-1 (dosage-sensitive sex reversal-adrenal hypoplasia congenita critical region on the X-chromosome, gene 1) selectively inhibits transactivation but not transrepression mediated by the glucocorticoid receptor in a LXXLL-dependent manner.
18408151 2008 Conservation analysis predicts in vivo occupancy of glucocorticoid receptor-binding sequences at glucocorticoid-induced genes.
18407829 2008 Role of the hinge region of glucocorticoid receptor for HEXIM1-mediated transcriptional repression.
18398271 A case of hypocortisolemic clinical Cushing's syndrome.
18396779 Changes of glucocorticoid receptor expression in the nasal polyps of patients with chronic sinusitis following treatment with glucocorticoid.
18385010 2008 TotalPlex gene amplification using bulging primers for pharmacogenetic analysis of acute lymphoblastic leukemia.
18362306 2008 Genotype-phenotype correlation in a family with primary cortisol resistance: possible modulating effect of the ER22/23EK polymorphism.
18343955 2008 Response to prednisone in relation to NR3C1 intron B polymorphisms in childhood nephrotic syndrome.
18337589 2008 Cross talk of signaling pathways in the regulation of the glucocorticoid receptor function.
18331827 2008 The novel gene AngRem104 downregulates glucocorticoid receptor expression and activates NF-kappaB in human mesangial cells.
18295813 2008 Activation of the glucocorticoid receptor releases unstimulated PBMCs from an early block in HIV-1 replication.
18286599 2008 Unipolar depression and hippocampal volume: impact of DNA sequence variants of the glucocorticoid receptor gene.
18269582 2008 Differential expression of glucocorticoid receptor in carcinomas of the human digestive system.
18248637 2008 The relationship between cortisol, muscle mass and muscle strength in older persons and the role of genetic variations in the glucocorticoid receptor.
18246526 2008 Glucocorticoid receptor gene polymorphisms in premenopausal women with major depression.
18219286 2008 Progesterone receptor variation and risk of ovarian cancer is limited to the invasive endometrioid subtype: results from the Ovarian Cancer Association Consortium pooled analysis.
18195193 2008 Glucocorticoid receptor gene and risk of cardiovascular disease.
18194492 2008 A common intron 2 polymorphism of the glucocorticoid receptor gene is associated with insulin resistance in men.
18182467 2008 Stimulation of both type I and type II corticosteroid receptors blunts counterregulatory responses to subsequent hypoglycemia in healthy man.
18165172 2007 Glucocorticoid receptor beta splice variant expression in patients with high and low activity of systemic lupus erythematosus.
18160712 2008 Doubling the size of the glucocorticoid receptor ligand binding pocket by deacylcortivazol.
18156379 2008 Polymorphisms of the glucocorticoid receptor gene in Graves ophthalmopathy.
18096310 2008 Activated glucocorticoid receptor interacts with the INHAT component Set/TAF-Ibeta and releases it from a glucocorticoid-responsive gene promoter, relieving repression: implications for the pathogenesis of glucocorticoid resistance in acute undifferentiated leukemia with Set-Can translocation.
18086889 2008 The HSA domain of BRG1 mediates critical interactions required for glucocorticoid receptor-dependent transcriptional activation in vivo.
18079322 2008 Glucocorticoid/glucocorticoid receptor inhibition of surfactant protein-A (SP-A) gene expression in lung type II cells is mediated by repressive changes in histone modification at the SP-A promoter.
18047640 2007 Glucocorticoid receptor gene polymorphisms associated with progression of lung disease in young patients with cystic fibrosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18028994 2008 The glucocorticoid receptor beta isoform can mediate transcriptional repression by recruiting histone deacetylases.
17989362 2008 Cell density and serum exposure modify the function of the glucocorticoid receptor C/EBP complex.
17978169 2008 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17952860 2008 Glucocorticoid receptor changes its cellular location with breast cancer development.
17951535 2007 Role of glucocorticoid receptor and CCAAT/enhancer-binding protein alpha in the feed-forward induction of 11beta-hydroxysteroid dehydrogenase type 1 expression by cortisol in human amnion fibroblasts.
17937535 2008 Sex-specific association of the glucocorticoid receptor gene with extreme BMD.
17853270 2007 The glucocorticoid receptor gene exon 1-F promoter is not methylated at the NGFI-A binding site in human hippocampus.
17848410 2007 The 23K variant of the R23K polymorphism in the glucocorticoid receptor gene protects against postnatal growth failure and insulin resistance after preterm birth.
17716631 2007 Sex specific associations between common glucocorticoid receptor gene variants and hypothalamus-pituitary-adrenal axis responses to psychosocial stress.
17704997 2007 Genetic association of a polymorphism of the cAMP-responsive element binding protein-binding protein with steroid-induced osteonecrosis after kidney transplantation.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17682054 2007 Selective regulation of bone cell apoptosis by translational isoforms of the glucocorticoid receptor.
17681029 2007 Serum fasting cortisol in relation to bone, and the role of genetic variations in the glucocorticoid receptor.
17635946 2007 A novel point mutation in helix 11 of the ligand-binding domain of the human glucocorticoid receptor gene causing generalized glucocorticoid resistance.
17633260 2007 [Expression of glucocorticoid receptor alpha and beta in chronic rhinosinusitis with nasal polyp].
17633252 2007 [Glucocorticoid receptor subunit expression in adenoid tissue of children with obstructive sleep apnea hypopnea syndrome].
17602195 2007 Aldosterone induces CTGF in mesangial cells by activation of the glucocorticoid receptor.
17592773 2008 Progesterone receptor polymorphisms and risk of breast cancer: results from two Australian breast cancer studies.
17572486 2007 Examination of Glucocorticoid receptor alpha-mediated transcriptional regulation of P-glycoprotein, CYP3A4, and CYP2C9 genes in placental trophoblast cell lines.
17563720 2007 The variant N363S of glucocorticoid receptor in steroid-induced ocular hypertension in Hungarian patients treated with photorefractive keratectomy.
17559307 2007 Determinants of cell- and gene-specific transcriptional regulation by the glucocorticoid receptor.
17556642 2007 Unfavorable socioeconomic conditions in early life presage expression of proinflammatory phenotype in adolescence.
17552871 2008 An evidence for regulatory cross-talk between aryl hydrocarbon receptor and glucocorticoid receptor in HepG2 cells.
17540466 2007 Bombesin attenuates pre-mRNA splicing of glucocorticoid receptor by regulating the expression of serine-arginine protein p30c (SRp30c) in prostate cancer cells.
17535992 2007 Molecular evidence for a link between the N363S glucocorticoid receptor polymorphism and altered gene expression.
17532759 2007 Glucocorticoid receptor gene polymorphisms and susceptibility to rheumatoid arthritis.
17522428 2007 Association of progesterone receptor gene polymorphism (PROGINS) with endometriosis, uterine fibroids and breast cancer.
17517920 2007 Conditional glucocorticoid receptor expression in the heart induces atrio-ventricular block.
17512111 2007 Progesterone, glucocorticoid, but not estrogen receptor mRNA is altered in breast cancer stroma.
17496926 2007 Glucocorticoid receptor overexpression exerts an antisurvival effect on human small cell lung cancer cells.
17490654 2007 Non-genomic effects of ginsenoside-Re in endothelial cells via glucocorticoid receptor.
17460547 2007 Pharmacogenetics of the 5-lipoxygenase biosynthetic pathway and variable clinical response to montelukast.
17442162 2007 [Expression of glucocorticoid receptor alpha and beta mRNA in orbital tissues in thyroid associated ophthalmopathy].
17438138 2007 Proteasome activity modulates chromatin modifications and RNA polymerase II phosphorylation to enhance glucocorticoid receptor-mediated transcription.
17407502 2007 Association between the BclI glucocorticoid receptor polymorphism and smoking in a sample of patients with obstructive airway disease.
17404046 2007 A new transcript splice variant of the human glucocorticoid receptor: identification and tissue distribution of hGR Delta 313-338, an alternative exon 2 transactivation domain isoform.
17395275 2007 Glucocorticoid receptor gene polymorphisms associated with more aggressive disease phenotype in MS.
17392827 2007 Gene-drug interaction at the glucocorticoid receptor increases risk of squamous cell skin cancer.
17382897 2007 Effect of thioredoxin reductase 1 on glucocorticoid receptor activity in human outer root sheath cells.
17291258 Progesterone receptor (PROGINS) polymorphism and the risk of endometrial cancer development.
17242172 2007 Associations between promoter usage and alternative splicing of the glucocorticoid receptor gene.
17242171 2007 Identification, tissue expression, and glucocorticoid responsiveness of alternative first exons of the human glucocorticoid receptor.
17239375 2007 Analysis of intranuclear binding process of glucocorticoid receptor using fluorescence correlation spectroscopy.
17236775 2007 Expression and significance of glucocorticoid receptor alpha in meningiomas.
17186943 2007 Chromatin-dependent cooperativity between site-specific transcription factors in vivo.
17185395 2007 Modulation of glucocorticoid receptor phosphorylation and transcriptional activity by a C-terminal-associated protein phosphatase.
17184882 2008 Glucocorticoid receptor variant and risk of dementia and white matter lesions.
17167179 2006 ADAMTS1, CRABP1, and NR3C1 identified as epigenetically deregulated genes in colorectal tumorigenesis.
17133261 2007 Mental performance in old age dependent on cortisol and genetic variance in the mineralocorticoid and glucocorticoid receptors.
17116691 2007 STAMP, a novel predicted factor assisting TIF2 actions in glucocorticoid receptor-mediated induction and repression.
17070695 2006 Role of glucocorticoid receptor gene in vulnerability for major depression: commentary on Neigh and Nemeroff.
17065567 2006 Spatial and temporal expression of glucocorticoid, retinoid, and thyroid hormone receptors is not altered in lungs of congenital diaphragmatic hernia.
17043312 2006 Role of Brg1 and HDAC2 in GR trans-repression of the pituitary POMC gene and misexpression in Cushing disease.
17003263 2006 UbcH7 interacts with the glucocorticoid receptor and mediates receptor autoregulation.
16980656 2006 The glucocorticoid receptor N363S polymorphism and steroid response in Duchenne dystrophy.
16973758 2007 Progesterone receptor repression of prolactin/signal transducer and activator of transcription 5-mediated transcription of the beta-casein gene in mammary epithelial cells.
16971495 2007 Acute activation of NHE3 by dexamethasone correlates with activation of SGK1 and requires a functional glucocorticoid receptor.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16914312 2006 Functional analysis of the LXXLL motifs of the human glucocorticoid receptor: association with altered ligand affinity.
16895953 2006 Associations of body size at birth with late-life cortisol concentrations and glucose tolerance are modified by haplotypes of the glucocorticoid receptor gene.
16890204 2006 Genetic variations of the NR3C1 gene in children with sporadic nephrotic syndrome.
16888650 2006 Glucocorticoids cause rapid dissociation of a T-cell-receptor-associated protein complex containing LCK and FYN.
16855182 2006 Association of glucocorticoid receptor polymorphism A3669G in exon 9beta with reduced central adiposity in women.
16849409 2006 A functional polymorphism in the glucocorticoid receptor gene and its relation to cardiovascular disease risk in familial hypercholesterolemia.
16809634 2006 Importin 13 regulates nuclear import of the glucocorticoid receptor in airway epithelial cells.
16806906 2006 Detection of the Bcl I polymorphism of the glucocorticoid receptor gene by single-tube allele-specific polymerase chain reaction.
16806572 2006 Glucocorticoid receptor expression in advanced non-small cell lung cancer: clinicopathological correlation and in vitro effect of glucocorticoid on cell growth and chemosensitivity.
16759008 2006 [Investigation of GR mRNA quantu expression in chronic sinusitis and nasal polyps].
16740143 2007 Glucocorticoid receptor polymorphisms and haplotypes associated with chronic fatigue syndrome.
16728546 2006 Potential advantage of N363S glucocorticoid receptor polymorphism in 21-hydroxylase deficiency.
16728402 2006 Glucocorticoid and androgen activation of monoamine oxidase A is regulated differently by R1 and Sp1.