Property Summary

Ligand Count 1,499
NCBI Gene PubMed Count 911
PubMed Score 2272.91
PubTator Score 3774.46

Knowledge Summary

Patent (124,718)

TINX Plot

  Disease (8)

Disease Target Count
Asthma 385
Acne vulgaris 15
Acquired thrombocytopenia 8
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 23
Adrenogenital disorder 6
Allergic Rhinitis Prevention 1
Allergic asthma 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 22
Allergic otitis externa 1
Allergic rhinitis 95
Alopecia areata 41
Angioedema 38
Ankylosing spondylitis 140
Anterior uveitis 3
Aphthous ulcer of mouth 7
Articular gout 11
Aspiration pneumonitis 6
Asthma management 19
Atopic dermatitis 952
Autoimmune disease 5
Autoimmune hemolytic anemia 31
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 28
Blepharoconjunctivitis 5
Branch retinal vein occlusion with macular edema 4
Bronchospasm Prevention with COPD 3
Burkitt's lymphoma 15
Bursitis 10
COPD Associated with Chronic Bronchitis 11
Candidiasis of skin 6
Central retinal vein occlusion with macular edema 4
Cerebral Edema 30
Chloasma 6
Choroiditis 5
Chronic Non-Allergic Rhinitis 1
Chronic lymphoid leukemia, disease 13
Chronic ulcerative proctitis 7
Congenital adrenal hyperplasia 73
Congenital hypoplastic anemia 8
Contact Dermatitis 81
Corneal Ulcer 21
Corneal abrasion 5
Crohn's disease 321
Crohn's disease in remission 1
Cyclitis 5
Cystic Aponeurosis Tumor 1
Dacryocystitis 11
Dermatitis herpetiformis 12
Dermatosis of scalp 1
Diagnostic Test for Cushing's Syndrome 5
Diffuse Proliferative Lupus Nephritis 1
Diffuse non-Hodgkin's lymphoma, large cell 12
Discoid lupus erythematosus 7
Disorder of eye 27
Disorder of musculoskeletal system 5
Disorder of skin 5
Eczema 45
Edema of larynx 5
Eosinophilic asthma 6
Epicondylitis 22
Eruption of skin 5
Erythema multiforme 17
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Exfoliative Erythroderma 1
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 7
Gingival Disorders 3
Granuloma annulare 5
Hemorrhoids 13
Herpes zoster keratitis 5
Herpes zoster keratoconjunctivitis 1
Hodgkin's disease 18
Humoral hypercalcemia of malignancy 6
Idiopathic thrombocytopenic purpura 5
Infection by larvae of Trichinella spiralis 3
Infective blepharitis 5
Infective otitis externa 4
Infective otitis media 3
Inflammatory bowel disease 151
Inflammatory dermatosis 3
Iridocyclitis 19
Iritis 8
Itching of ear 3
Juvenile rheumatoid arthritis 111
Keloid scar 1
Keratitis 62
Lichen planus 16
Lichen simplex chronicus 7
Löffler's syndrome 5
Malignant otitis externa due to Pseudomonas aeruginosa 4
Mastoidectomy Cavity Infections 3
Meibomianitis 4
Miliary tuberculosis 6
Minor Bacterial Skin Infections 3
Multiple Sclerosis 540
Multiple myeloma 1332
Mycosis fungoides 29
Nasal polyp 1
Necrobiosis lipoidica diabeticorum 1
Nephrotic Syndrome 78
Non-Hodgkin's lymphoma 22
Non-allergic asthma 5
Non-infectious Posterior Uveitis 1
Nummular eczema 1
Ocular rosacea 4
Otitis Externa Eczema 1
Otitis Externa Seborrhea 1
Otitis externa 10
Pemphigus 23
Perennial allergic rhinitis 2
Perforation of cornea 1
Pityriasis simplex 6
Plaque psoriasis 17
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 9
Postoperative Ocular Pain 5
Pregnancy with abortive outcome 12
Prevention of Transplant Rejection 6
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Proctitis 13
Progressive Diffuse Large B-Cell Lymphoma 4
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Pulmonary emphysema 48
Punctate keratitis 1
Punctate keratopathy 5
Recurrent herpes simplex labialis 3
Rheumatic heart disease 10
Rheumatoid arthritis 1191
Rhinitis 55
Rosacea 25
Scalp psoriasis 6
Seasonal allergic rhinitis 9
Seborrheic dermatitis 31
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Staphylococcus Aureus Otitis Externa 4
Stevens-Johnson syndrome 92
Subacute bursitis 1
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 78
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Systemic lupus erythematosus 194
Tendinitis 14
Tenosynovitis 14
Thyroiditis 29
Tinea corporis 25
Tinea cruris 12
Tinea pedis 29
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Tuberculosis Meningitis Treatment Adjunct 1
Uveitis 103
Vasomotor rhinitis 13
Vitrectomy Adjunct to Enhance Visualization 1
psoriasis 6694
sarcoidosis 370
ulcerative colitis 1819
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Pseudohermaphroditism 16 0.0 4.0
Disease Target Count
Glucocorticoid resistance 1

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis -1.267 3.3e-02
atypical teratoid / rhabdoid tumor -1.400 9.4e-04
Breast cancer -1.600 7.1e-08
breast carcinoma -1.100 9.6e-04
ductal carcinoma in situ -1.400 2.4e-04
group 3 medulloblastoma -1.400 3.9e-03
intraductal papillary-mucinous carcinoma... -2.300 1.4e-02
invasive ductal carcinoma -1.900 3.7e-04
lung cancer -1.300 7.4e-04
medulloblastoma, large-cell -1.800 2.0e-03
Multiple myeloma 1.274 8.4e-03
osteosarcoma 1.663 5.8e-05
ovarian cancer -2.200 3.6e-05
primitive neuroectodermal tumor -1.200 4.5e-02
psoriasis -1.100 1.7e-06
tuberculosis -1.200 4.6e-07

Protein-protein Interaction (4)

Gene RIF (798)

AA Sequence

MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSV      1 - 70
SNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK     71 - 140
SSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNE    141 - 210
SPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEK    211 - 280
EDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI    281 - 350
FNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL    351 - 420
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEA    421 - 490
RKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIM    491 - 560
TTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIIN    561 - 630
EQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKA    631 - 700
IVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIK    701 - 770
KLLFHQK                                                                   771 - 777
//

Text Mined References (935)

PMID Year Title