Property Summary

NCBI Gene PubMed Count 66
PubMed Score 160.31
PubTator Score 89.68

Knowledge Summary

Patent (10,724)

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -2.400 9.9e-08
astrocytic glioma -1.400 3.4e-02
ependymoma -1.400 4.8e-02
oligodendroglioma -1.300 3.7e-02
psoriasis -4.000 3.3e-06
atypical teratoid / rhabdoid tumor 2.100 1.9e-03
glioblastoma 1.400 1.8e-02
medulloblastoma, large-cell 1.400 2.1e-03
primitive neuroectodermal tumor 2.500 4.1e-06
Duchenne muscular dystrophy 1.331 1.6e-05
autosomal dominant Emery-Dreifuss muscul... 1.480 8.9e-03
juvenile dermatomyositis 1.654 3.1e-11
acute quadriplegic myopathy 1.042 4.0e-03
primary pancreatic ductal adenocarcinoma 1.128 9.4e-04
pediatric high grade glioma 1.300 1.0e-02
sonic hedgehog group medulloblastoma 1.700 5.8e-04
primary Sjogren syndrome 1.300 3.8e-04
lung adenocarcinoma -1.400 3.2e-09
pulmonary arterial hypertension -1.100 4.5e-02
Pick disease 1.200 1.4e-02
ovarian cancer -2.300 2.5e-05
pancreatic cancer 1.300 2.5e-04
dermatomyositis 1.800 1.3e-03

 GO Component (1)

Protein-protein Interaction (6)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
686940 screening 2610 / 0 / 367666 Luminescence-based cell-based primary high throughput screening assay to identify inhibitors of COUP-TFII (NR2F2)
686953 summary 0 / 0 / 0 Summary of a probe development effort to identify inhibitors of COUP-TFII (NR2F2)
687008 screening 1133 / 0 / 1364 Luminescence-based cell-based high throughput confirmation assay to identify inhibitors of COUP-TFII (NR2F2)
720548 confirmatory 173 / 0 / 59 Luminescence-based cell-based high throughput dose response assay to identify inhibitors of COUP-TFII (NR2F2)

Gene RIF (44)

PMID Text
26261604 Positive COUP-TF II expression levels has significant value in determining CRC stage and metastasis and cooperates with negative Smad4 expression contributing to assess prognosis in patients with colorectal cancer.
25687954 COUP-TFII (NR2F2) induces down-regulation of cadherin-6 and up-regulation of cadherin-11 in cultured cell lines.high expression of COUP-TFII in some gastric and oesophageal adenocarcinomas, correlated with abnormal cadherin-11 expression.
25372459 These data demonstrate that Nr2f2 is a direct target of POU4F3 in vitro and that this regulatory relationship may be relevant to hair cell development and survival.
25129343 TGF-beta inhibited the expression of NR2F2.
25032732 Overexpression of COUP-TFII was required for cancer cells to metastasise in vivo.
24702954 showed that all six coding sequence variants observed in individuals significantly alter the activity of NR2F2 on target promoters
24176914 COUP-TFII plays a role in controlling the expression of inflammatory cytokines.
24141032 These data indicate a novel role for COUP-TFII in suppression of NFkappaB activity.
24122412 In vitro silencing of COUP-TFII reduces the cell growth.
24058409 Using several human red opsin enhancer/promoter-luciferase reporter constructs, the study found that COUPTFII suppressed intron 3-4 region-dependent luciferase activities.
23975195 COUP-TFII and related NRs such as the COUPTFs and PNR can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates COUP-TFII-mediated repression of the RARb2 gene.
23975195 Interaction of NSD1 with the NR2E/F subfamily including COUP-TFI, COUP-TFII, EAR2 and TLX requires a F/YSXXLXXL/Y motif. NSD1 interaction with liganded NRs is mediated by an overlapping LXXLL motif.
23744056 Hey2 and COUP-TFII have an important role in arteriovenous differentiation of human endothelial cells.
23704310 Data suggest that NR2F2 and CTNNB1 (catenin beta-1) are aberrantly expressed in uterine fibroid tissue compared with matched myometrium, with strong blood vessel-specific localization.
23690307 Data suggest that NR2F2 is expressed in stromal cells of healthy ovary with little/no expression in epithelial cells; this pattern is markedly disrupted in ovarian cancers with decreased NR2F2 in stroma and ectopic NR2F2 expression in epithelium.
23458092 COUP-TFII-V2 negatively regulates the function of COUP-TFII by inhibiting its binding to DNA, decreasing Cyp7a1 expression.
23345397 COUP-TFII orchestrates venous and lymphatic endothelial identity by homo- or hetero-dimerisation with PROX1
23201680 findings reveal that the destruction of the TGF-beta-dependent barrier by COUP-TFII is crucial for the progression of PTEN-mutant prostate cancer into a life-threatening disease
23136034 MiR-302 inhibits NR2F2 and promotes pluripotency through indirect positive regulation of OCT4.
22734039 COUP-TFII regulates vein identity by suppressing the Notch signal pathway.
22693611 nucleolin plays a coregulatory role in transcriptional regulation of the tumor suppressor RARB2 by COUP-TFII
22606236 The C-allele at rs3743462 was associated with increased NR2F2 binding and decreased NR2F2 gene expression.
22493443 COUP-TFII negatively regulates osteoblast differentiation via interaction with Runx2, and during the differentiation state, BMP2-induced Runx2 represses COUP-TFII expression and promotes osteoblast differentiation.
22178710 In summary, COUP-TFII is expressed in the human fetal forebrain in GABAergic cells, according to its possible role in migration of cortical interneurons.
21151097 NR2F2 plays a crucial role in the activation of neural genes during early differentiation in humans.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585627 Observational study of gene-disease association. (HuGE Navigator)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20386594 role for the TGFbeta pathway and COUP-TFII in mediating the endothelial transdifferentiating properties of retinoic acid
20351309 Data suggest a novel model that the endothelial cell fate regulators, Notch, COUP-TFII, and Prox1, are under an exquisite feedback control mechanism and dynamically regulate each other in LECs.
20195529 Results strongly suggest that NR2F2 is involved in villous CTB cell differentiation and that NR2F2 acts, at least in part, by directly activating TFAP2A gene expression and by potentiating the transactivation of TFAP2A by RARA and RXRA.
20147377 Novel and distinct cell-intrinsic mechanisms mediated by COUP-TF genes to direct the specification and differentiation of progenitor cells; COUP-TFs are crucial for dorsalization of the eye.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19210544 The present study shows that COUP-TFII plays important roles in the regulation of the function of Prox1.
19154418 COUP-TFII was investigated as a possible regulator of lymphangiogenesis via vascular endothelial growth factor-C expression.
19082449 COUP-TFII may represent a biomarker for good prognosis in colorectal cancer.
18815287 venous endothelial cell fate regulator COUP-TFII is expressed in lymphatic cells throughout development and physically interacts with Prox1 to form a stable complex in various cell types
18798693 Data demonstrate that COUP-TFII is a ligand-regulated nuclear receptor, in which ligands activate the receptor by releasing it from the autorepressed conformation.
18765665 COUP-TFII antagonizes the repression of the PED/PEA-15 gene by HNF-4alpha.
18199540 Regulation of vascular endothelial growth factor D by hepatocyte nuclear factor-4 alpha and chicken ovalbumin upstream promoter transcription factors 1 and 2.
17455195 the DR motif site of the renin gene functions as a negative regulatory element involved in a twofold repression of transcription; nucleic receptors bind the site and are important in renin gene expression; one of the binding proteins may be COUP-TFII.
15265774 GR stimulates COUP-TFII-induced transactivation by attracting cofactors via its activation function-1, while COUP-TFII represses the GR-governed transcriptional activity by tethering corepressors ...
12843196 DAX-1 and COUP-TFII may play a role in the modulation of Ad4BP/SF-1-dependent transcription of steroidogenic enzymes in different cell types and follicular stages in normal cycling human ovaries.
12614160 COUP-TFII represses the alpha-subunit of mitochondrial F1F0 ATP synthase (ATPA) complex and inhibits the USF2-dependent transactivation of the ATPA promoter through competition for an overlapping bindng site in the ATPA cis-acting regulatory element 1.

AA Sequence

MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDK      1 - 70
QQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCL     71 - 140
KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIE    141 - 210
NICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPM    211 - 280
SADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVR    281 - 350
SQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ          351 - 414
//

Text Mined References (71)

PMID Year Title
26261604 2015 High expression of COUP-TF II cooperated with negative Smad4 expression predicts poor prognosis in patients with colorectal cancer.
25687954 2015 Involvement of orphan nuclear receptor COUP-TFII in cadherin-6 and cadherin-11 regulation: implications in development and cancer.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25372459 2014 Regulation of the orphan nuclear receptor Nr2f2 by the DFNA15 deafness gene Pou4f3.
25129343 2014 High NR2F2 transcript level is associated with increased survival and its expression inhibits TGF-?-dependent epithelial-mesenchymal transition in breast cancer.
25032732 2014 COUP-TFII regulates metastasis of colorectal adenocarcinoma cells by modulating Snail1.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24702954 2014 Rare variants in NR2F2 cause congenital heart defects in humans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24176914 2013 COUP-TFII regulates human endometrial stromal genes involved in inflammation.
24141032 2014 COUP-TFII inhibits NFkappaB activation in endocrine-resistant breast cancer cells.
24122412 2014 COUP-TFII in pancreatic adenocarcinoma: clinical implication for patient survival and tumor progression.
24058409 2013 Enhancer/promoter activities of the long/middle wavelength-sensitive opsins of vertebrates mediated by thyroid hormone receptor ?2 and COUP-TFII.
23975195 2013 A signature motif mediating selective interactions of BCL11A with the NR2E/F subfamily of orphan nuclear receptors.
23744056 2013 Impact of Hey2 and COUP-TFII on genes involved in arteriovenous differentiation in primary human arterial and venous endothelial cells.
23704310 2013 Aberrant expression and regulation of NR2F2 and CTNNB1 in uterine fibroids.
23690307 2013 Expression and functional pathway analysis of nuclear receptor NR2F2 in ovarian cancer.
23458092 2013 The COUP-TFII variant lacking a DNA-binding domain inhibits the activation of the Cyp7a1 promoter through physical interaction with COUP-TFII.
23345397 2013 COUP-TFII orchestrates venous and lymphatic endothelial identity by homo- or hetero-dimerisation with PROX1.
23201680 2013 COUP-TFII inhibits TGF-?-induced growth barrier to promote prostate tumorigenesis.
23136034 2013 MicroRNA-302 increases reprogramming efficiency via repression of NR2F2.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22734039 2012 COUP-TFII is a major regulator of cell cycle and Notch signaling pathways.
22693611 2012 Identification and characterization of nucleolin as a COUP-TFII coactivator of retinoic acid receptor ? transcription in breast cancer cells.
22606236 2012 Glucose-dependent regulation of NR2F2 promoter and influence of SNP-rs3743462 on whole body insulin sensitivity.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
22493443 2012 Orphan nuclear receptor chicken ovalbumin upstream promoter-transcription factor II (COUP-TFII) protein negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation through suppressing runt-related gene 2 (Runx2) activity.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22178710 2012 COUP-TFII expressing interneurons in human fetal forebrain.
21269460 2011 Initial characterization of the human central proteome.
21151097 2011 A regulatory circuitry comprised of miR-302 and the transcription factors OCT4 and NR2F2 regulates human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20386594 2010 Retinoic acid mediates regulation of network formation by COUP-TFII and VE-cadherin expression by TGFbeta receptor kinase in breast cancer cells.
20351309 2010 An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells.
20195529 2010 Involvement of transcription factor NR2F2 in human trophoblast differentiation.
20147377 2010 COUP-TFs regulate eye development by controlling factors essential for optic vesicle morphogenesis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19210544 2009 COUP-TFII regulates the functions of Prox1 in lymphatic endothelial cells through direct interaction.
19154418 2009 Chicken ovalbumin upstream promoter transcription factor II in human breast carcinoma: possible regulator of lymphangiogenesis via vascular endothelial growth factor-C expression.
19082449 2009 Clinical significance of chicken ovalbumin upstream promoter-transcription factor II expression in human colorectal cancer.
18815287 2009 Prox1 physically and functionally interacts with COUP-TFII to specify lymphatic endothelial cell fate.
18798693 2008 Identification of COUP-TFII orphan nuclear receptor as a retinoic acid-activated receptor.
18765665 2008 Molecular cloning and characterization of the human PED/PEA-15 gene promoter reveal antagonistic regulation by hepatocyte nuclear factor 4alpha and chicken ovalbumin upstream promoter transcription factor II.
18619963 2008 DNA-binding profiling of human hormone nuclear receptors via fluorescence correlation spectroscopy in a cell-free system.
18199540 2008 Regulation of vascular endothelial growth factor D by orphan receptors hepatocyte nuclear factor-4 alpha and chicken ovalbumin upstream promoter transcription factors 1 and 2.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17455195 2007 A proximal direct repeat motif characterized as a negative regulatory element in the human renin gene.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15666827 2004 COUP-TF and transcriptional co-regulators in adrenal steroidogenesis.
15611122 2005 Ubc9 and Protein Inhibitor of Activated STAT 1 Activate Chicken Ovalbumin Upstream Promoter-Transcription Factor I-mediated Human CYP11B2 Gene Transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15265774 2004 Interaction of the glucocorticoid receptor and the chicken ovalbumin upstream promoter-transcription factor II (COUP-TFII): implications for the actions of glucocorticoids on glucose, lipoprotein, and xenobiotic metabolism.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12843196 2003 Immunolocalization of nuclear transcription factors, DAX-1 and COUP-TF II, in the normal human ovary: correlation with adrenal 4 binding protein/steroidogenic factor-1 immunolocalization during the menstrual cycle.
12614160 2003 Transcriptional regulation of the nuclear gene encoding the alpha-subunit of the mammalian mitochondrial F1F0 ATP synthase complex: role for the orphan nuclear receptor, COUP-TFII/ARP-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11544252 2001 Cooperation and competition between the binding of COUP-TFII and NF-Y on human epsilon- and gamma-globin gene promoters.
10744719 2000 Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors.
10704340 2000 Association of histone deacetylase with COUP-TF in tumorigenic Ad12-transformed cells and its potential role in shut-off of MHC class I transcription.
10318855 1999 Heterodimeric interactions between chicken ovalbumin upstream promoter-transcription factor family members ARP1 and ear2.
9826778 1998 The orphan nuclear receptor, COUP-TF II, inhibits myogenesis by post-transcriptional regulation of MyoD function: COUP-TF II directly interacts with p300 and myoD.
9343308 1997 The nuclear orphan receptors COUP-TFII and Ear-2 act as silencers of the human oxytocin gene promoter.
9115274 1997 Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.
8910285 1996 A p56(lck) ligand serves as a coactivator of an orphan nuclear hormone receptor.
8530078 1995 Isolation, characterization, and chromosomal localization of mouse and human COUP-TF I and II genes.
1899293 1991 Regulation of the apolipoprotein AI gene by ARP-1, a novel member of the steroid receptor superfamily.
1820218 1991 The COUP-TFs compose a family of functionally related transcription factors.
1312668 1992 Antagonism between apolipoprotein AI regulatory protein 1, Ear3/COUP-TF, and hepatocyte nuclear factor 4 modulates apolipoprotein CIII gene expression in liver and intestinal cells.