Property Summary

NCBI Gene PubMed Count 39
PubMed Score 44.20
PubTator Score 21.58

Knowledge Summary

Patent (15,849)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -2.600 2.9e-03
posterior fossa group A ependymoma -3.100 1.8e-09
oligodendroglioma -2.100 8.7e-03
medulloblastoma -3.400 8.6e-06
medulloblastoma, large-cell -2.900 9.9e-03
pilocytic astrocytoma -2.300 8.1e-04
subependymal giant cell astrocytoma 3.443 2.7e-02

 GO Component (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (31)

PMID Text
26965827 TLX and miR-219 have an important role in both normal neurodevelopment and in schizophrenia patient iPSC-derived NSCs. TLX has a role in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation.
26838672 TLX downregulation induces TET3 expression and inhibits glioblastoma tumorigenesis and self-renewal in glioblastoma stem cells.
26554934 TLX biological role in mental illness and gliomagenesis
26280373 TLX has a role in regulating growth and invasion in ERalpha-negative breast cancer cells
25813674 Increased NR2E1 level may be closely associated with inflammation and disorder of lipid and glucose metabolism in diabetic patients.
25557355 TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes
25356871 The effect of TLX on the proliferative, invasive and migratory properties of IMR-32 cells attributed to the recruitment of TLX to both MMP-2 and Oct-4 gene promoters, which resulted in the respective gene activation.
25328137 NR2E1 regulates CBX7 and restrains senescence in neural stem cells.
25327364 These results suggest that let-7b, by forming a negative feedback loop with TLX, provides a novel model to regulate the proliferation and differentiation of retinal progenitors in vitro
23975195 TLX/NR2E1 and related NRs such as PNR and COUPTFs can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates TLX-mediated repression of the RARb2 gene.
23975195 Interaction of NSD1 with the NR2E/F subfamily including COUP-TFI, COUP-TFII, EAR2 and TLX requires an F/YSXXLXXL/Y motif. Interactions of NSD1 with liganded NRs require an overlapping LXXLL motif.
23510989 TLX is involved in interleukin (IL)-1beta-induced changes in adult hippocampal neurogenesis.
23213277 No mutations in the NR2E1 gene were found in aniridia patients.
23028043 Enriched expression of TLX in higher-grade human gliomas is observed.
22675500 BCL11A is a novel TLX coregulator that might be involved in TLX-dependent gene regulation in the brain.
22290436 Cerebrum and olfactory bulb hypoplasia, hallmarks of the Nr2e1-null mice phenotype, were not fully corrected in animals harboring one functional copy of human NR2E1.
21957244 Transgenic TLX acts as an essential regulator that ensures the proliferative ability of postnatal neural stem cells by controlling their activation through genetic interaction with p53 and other signaling pathways.
21368052 Transgenic mice lacking microRNAs miR-9-2 and miR-9-3 exhibit multiple defects of telencephalic structures which may be brought about by dysregulation of Foxg1, Nr2e1, Gsh2, and Meis2 expression.
21135096 Nuclear orphan receptor TLX induces Oct-3/4 for the survival and maintenance of adult hippocampal progenitors upon hypoxia.
20814749 Increased TLX expression was observed in a number of glioma cells and glioma stem cells, and correlated with poor survival of patients with gliomas.
20360385 nuclear receptor tailless transcripts are overexpressed in human primary glioblastomas in which Tlx expression is restricted to a subpopulation of nestin-positive perivascular tumor cells
19555662 TLX is an inducer of SIRT1 and may contribute to neurogenesis both as a transactivator and as a repressor.
19058789 Observational study of gene-disease association. (HuGE Navigator)
18391013 LSD1 is a histone demethylase that is the prime corepressor for TLX
18205168 Genetic variation at NR2E1 may be associated with susceptibility to brain-behavior disorders.
18205168 Observational study of gene-disease association. (HuGE Navigator)
17873065 TLX recruits histone deacetylases to repress transcription of p21(CIP1/WAF1) and pten and regulate neural stem cell proliferation
17655765 we cannot exclude the possibility that deletions at NR2E1 may underlie MMEP, given that sequencing is unable to distinguish between homozygosity across loci versus large deletions
17054721 Strong purifying selection, low genetic diversity, 21 novel polymorphisms and five common haplotypes at were detected at NR2E1; protein-coding changes do not contribute to cortical and behavioral abnormalities, but regulatory mutations may play a role.
16000615 Transgenic human NR2E1 was sufficient to fix structural brain & eye abnormalities & hyperaggressiveness in mice deleted for mouse Nr2e1. NR2E1 protein & regulatory sequences are comparable between these species.
12079282 compared sequence from human, mouse, and the puffer fish Fugu rubripes

AA Sequence

MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQC      1 - 70
RACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPH     71 - 140
GLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLS    141 - 210
LQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRL    211 - 280
DATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPAL    281 - 350
RSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI                                       351 - 385
//

Text Mined References (40)

PMID Year Title
26965827 2016 The TLX-miR-219 cascade regulates neural stem cell proliferation in neurodevelopment and schizophrenia iPSC model.
26838672 2016 Downregulation of TLX induces TET3 expression and inhibits glioblastoma stem cell self-renewal and tumorigenesis.
26554934 2016 TLX: An elusive receptor.
26280373 2015 Expression profiling of nuclear receptors in breast cancer identifies TLX as a mediator of growth and invasion in triple-negative breast cancer.
26059414 2015 Integrative epigenomic and genomic filtering for methylation markers in hepatocellular carcinomas.
25813674 The relationship between NR2E1 and subclinical inflammation in newly diagnosed type 2 diabetic patients.
25691470 2015 Structural basis for corepressor assembly by the orphan nuclear receptor TLX.
25557355 2015 Orphan nuclear receptor TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes.
25356871 2014 TLX activates MMP-2, promotes self-renewal of tumor spheres in neuroblastoma and correlates with poor patient survival.
25328137 2015 The nuclear receptor NR2E1/TLX controls senescence.
25327364 2014 Effects of let-7b and TLX on the proliferation and differentiation of retinal progenitor cells in vitro.
23975195 2013 A signature motif mediating selective interactions of BCL11A with the NR2E/F subfamily of orphan nuclear receptors.
23510989 2013 Negative regulation of TLX by IL-1? correlates with an inhibition of adult hippocampal neural precursor cell proliferation.
23213277 2012 Absence of NR2E1 mutations in patients with aniridia.
23028043 2012 The nuclear receptor TLX is required for gliomagenesis within the adult neurogenic niche.
22675500 2012 The oncoprotein BCL11A binds to orphan nuclear receptor TLX and potentiates its transrepressive function.
22290436 2012 Retina restored and brain abnormalities ameliorated by single-copy knock-in of human NR2E1 in null mice.
21957244 2011 Activation of postnatal neural stem cells requires nuclear receptor TLX.
21368052 2011 MicroRNA-9 regulates neurogenesis in mouse telencephalon by targeting multiple transcription factors.
21135096 2011 Nuclear orphan receptor TLX induces Oct-3/4 for the survival and maintenance of adult hippocampal progenitors upon hypoxia.
20814749 2010 The neural stem cell fate determinant TLX promotes tumorigenesis and genesis of cells resembling glioma stem cells.
20360385 2010 The nuclear receptor tailless induces long-term neural stem cell expansion and brain tumor initiation.
19555662 2009 Transcriptional activation of NAD+-dependent protein deacetylase SIRT1 by nuclear receptor TLX.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18391013 2008 Transrepressive function of TLX requires the histone demethylase LSD1.
18205168 2008 Initial association of NR2E1 with bipolar disorder and identification of candidate mutations in bipolar disorder, schizophrenia, and aggression through resequencing.
17873065 2007 Orphan nuclear receptor TLX recruits histone deacetylases to repress transcription and regulate neural stem cell proliferation.
17655765 2007 Absence of mutations in NR2E1 and SNX3 in five patients with MMEP (microcephaly, microphthalmia, ectrodactyly, and prognathism) and related phenotypes.
17054721 2007 Mutation and evolutionary analyses identify NR2E1-candidate-regulatory mutations in humans with severe cortical malformations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16000615 2005 Pathological aggression in "fierce" mice corrected by human nuclear receptor 2E1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12079282 2002 Novel vertebrate genes and putative regulatory elements identified at kidney disease and NR2E1/fierce loci.
11073974 2000 Cell-type-specific regulation of the retinoic acid receptor mediated by the orphan nuclear receptor TLX.
9628820 1998 The human homologue of the Drosophila tailless gene (TLX): characterization and mapping to a region of common deletion in human lymphoid leukemia on chromosome 6q21.
8047143 1994 Relationship between Drosophila gap gene tailless and a vertebrate nuclear receptor Tlx.
2570372 1989 Nordihydroguaiaretic acid blocks the synaptic component of long-term potentiation and the associated increases in release of glutamate and arachidonate: an in vivo study in the dentate gyrus of the rat.