Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.49
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.5e-09

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.052 2.5e-09

Gene RIF (5)

AA Sequence

MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGF      1 - 70
SSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV      71 - 139
//

Text Mined References (13)

PMID Year Title