Property Summary

Ligand Count 4
NCBI Gene PubMed Count 96
PubMed Score 45.77
PubTator Score 61.44

Knowledge Summary

Patent (24,606)

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.442 9.6e-06
Breast cancer 3.700 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.0e-02
juvenile dermatomyositis 1.220 5.7e-11
osteosarcoma -1.808 4.0e-05
ovarian cancer -2.600 4.1e-11
primary pancreatic ductal adenocarcinoma 1.098 5.4e-03
psoriasis -2.100 7.9e-05
subependymal giant cell astrocytoma -1.284 6.2e-03

 GO Component (1)

Protein-protein Interaction (1)

Gene RIF (68)

AA Sequence

MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPE      1 - 70
TSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGF     71 - 140
FKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK    141 - 210
IYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANV    211 - 280
VTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQ    281 - 350
STPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR    351 - 420
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGY    421 - 490
EYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEE    491 - 560
LFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL                                      561 - 596
//

Text Mined References (108)

PMID Year Title