Property Summary

NCBI Gene PubMed Count 94
PubMed Score 258.05
PubTator Score 341.70

Knowledge Summary

Patent (13,855)

Expression

Protein-protein Interaction (11)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (77)

PMID Text
26275810 These results reveal both novel and known targets of hCAR and support the role of hCAR in maintaining the homeostasis of metabolism and cell proliferation in the liver.
26188155 The homozygous variant genotype of MPJ6_1I3008 is associated with a significant reduced risk of neonatal hyperbilirubinemia in females.
25835148 Suggest that PXR and CAR double humanized mice are more sensitive rifampcin induction of cytochrome P450 and UDP-glucuronosyltransferases.
25721668 PRMT5 enhances transcriptional activity of constitutive androstane receptor.PRMT5 is a gene-selective co-activator for CAR.
25356900 Around 42.5% of the overall interindividual variability in warfarin dose requirements was explained : VKORC1 genotype accounted for 29.6%, CYP2C9 genotype for 4.3%, age for 3.6%, the CYP4F2 genotype for 3.3%, and CAR/HNF4alpha (rs2501873/rs3212198) for 1.7%
25155144 The nuclear receptor constitutive androstane receptor/NR1I3 enhances the profibrotic effects of transforming growth factor beta and contributes to the development of experimental dermal fibrosis.
24859622 It is suggested that the functions of PXR, CAR and AhR may be closely implicated in the pathogeneses of metabolic vascular diseases, such as hyperlipidemia, atherogenesis, and hypertension.
24789201 ubiquitin-proteasomal regulation of CCRP and HSP70 are important contributors to the regulation of cytoplasmic CAR levels, and hence the ability of CAR to respond to PB or PB-like inducers
24351870 Donor CYP3A5, NR1I3 gene polymorphisms.
24232815 The polymorphisms investigated in PPARA (rs1800206), RXRA (rs11381416), and NR1I2 (rs1523130) did not influence the lipid-lowering efficacy and safety of statin and our results show the possible influence of NR1I3 genetic variant on the safety of statin.
24104474 Gadd45B protects the liver through two entirely different processes: binding MKK7 to block damaging signal transduction or binding CAR to coactivate anabolic transcription. (Review)
23934188 miR-137 is a crucial regulator of cancer response to doxorubicin treatment
23614276 Report CAR expression in human parotid glands.
23578392 Constitutive androstane receptor-mediated enzyme induction in the liver depends on the presence of beta-catenin at the time of xenobiotic treatment.
23539296 Activated p38 MAPK is required for CAR to selectively activate a set of genes that encode drug-metabolizing enzymes.
23303387 Common genetic variants in the xenobiotic transport and metabolism regulator genes PXR and CAR do not have a significant association with multiple myeloma risk.
23172109 CYP2B6 516G>T (P < 0.0001) and CAR rs2307424 C>T (P = 0.002) were significantly related to efavirenz plasma concentrations.
23079705 Polymorphisms in the RXRA and NR1I3 genes influence lipid profile in a Southern Brazilian population.
22978668 The CAR variant, which results in a poor metabolizer phenotype, could account for a higher degree of external genitalia virilization in 21OHD females.
22910411 DP97 was found to be a gene (or promoter)-selective co-activator for hCAR
22896671 DAX-1 as a novel and potent constitutive androstane receptor (CAR) corepressor and suggest that DAX-1 functions as a coordinate hepatic regulator of CAR's biological function.
22815988 phenobarbital-mediated down-regulation of miR-122 is an early and important event in the AMPK-dependent CAR activation and transactivation of its target genes
22093699 CAR transactivates ABCG2 through the DR5 motif located in its distal promoter in hepatocytes and the motif prefers CAR to pregnane X receptor.
21873423 activated ERK1/2 interacts with CAR and represses dephosphorylation of Thr-38, providing a cell signal-regulated mechanism for CAR activation.
21733368 In severe intrahepatic cholestasis of pregnancy the CAR expression in placenta syncytiotrophoblastic cells increased appreciably, which may be involved in the maintenance of placenta barrier function and protection.
21715435 These data indicate that genetic variability in CYP2B6 and constitutive androstane receptor contributes to early treatment discontinuation for efavirenz-based antiretroviral regimens
21517853 These findings provide the first evidence for P-glycoprotein regulation by pregnane X receptor and constitutive androstane receptor at the human blood brain barrier.
21415305 results suggest that HNF4alpha plays an important role in the constitutive expression of hepatic UGT2B7, and CAR acts as a negative regulator by interfering with HNF4alpha binding activity
21359593 CAR mRNA levels were unchanged while protein levels were markedly induced in obstructive cholestasis as compared with the controls.
21296199 FXR activation in obstructive cholestasis might worsen liver injury by hijacking a protective mechanism regulated by CAR and provides a new molecular explanation to the pathophysiology of cholestasis.
20966044 constitutive androstane receptor (hCAR) mediated the CYP2B6 induction by cigarette smoke extract in Hep2G cells; data suggest that smoking up-regulates CYP2B6 through hCAR in vivo
20622021 CCAAT/enhancer-binding protein alpha (C/EBPalpha) and hepatocyte nuclear factor 4alpha (HNF4alpha) synergistically cooperate with constitutive androstane receptor to transactivate the human cytochrome P450 2B6 (CYP2B6) gene
20218903 Four haplotypes were determined for CAR single nucleotide polymorphisms.
20218903 Observational study of genotype prevalence. (HuGE Navigator)
20197307 Data observed that OSM positively augmented the CAR and UGT1A1 expressions and CAR-mediated signaling in vivo and in vitro, through cross talk between the nuclear CAR receptor and the plasma membrane OSM receptor, via the MAPK cascade.
19858220 Results characterize the conserved threonine 38 of human constitutive active/androstane receptor (CAR) as the primary residue that regulates nuclear translocation and activation of CAR.
19702932 A genetic variation at the CAR gene locus is associated with BMD, suggesting an involvement of the CAR gene in bone metabolism
19682433 ER8 motif is highly conserved in the CYP1A1 proximal promoter sequences of various species, suggesting a fundamental role of CAR in the xenobiotic-induced expression of CYP1A1 and CYP1A2 independent of aryl hydrocarbon receptor
19302787 CAR expression may be mediated by phosphorylated Elk-1 via the SAPK signaling pathway
19034627 Bioactive terpenoids and flavonoids from Ginkgo biloba extract induce the expression of hepatic drug-metabolizing enzymes through pregnane X receptor, constitutive androstane receptor, and aryl hydrocarbon receptor-mediated pathways.
18713018 SF3a3 functions as a co-repressor of Constitutive Androstane Receptor transcriptional activity, in addition to its canonical function.
18332083 ATF5 is abundant in the liver, activates CYP2B6, and cooperates with CAR in sustaining the hepatic-specific expression of this P450 in human hepatocytes and hepatoma cells.
18331826 CAR may influence the expression of genes involved in not only the metabolism of endogenous and exogenous substances but also in the cell proliferation.
18305370 In this review, constitutive active/androstane receptor (CAR) is a nuclear receptor that plays a critical role in modulating hepatic energy metabolism.
18303024 CAR requires early growth response 1 to activate the human cytochrome P450 2B6 gene
18294295 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18202305 R16A at the membrane may mediate the PB signal to initiate CAR nuclear translocation, through a mechanism including its dimerization and inhibition of PP1beta activity.
18154449 genetic polymorphisms in CAR may have an indirect effect on drug disposition--REVIEW
18056193 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17962186 PPARalpha ligands not only serve as PPARalpha agonists but possibly act as CAR antagonists.
17888866 the human cathepsin E gene is regulated by the constitutive androstane receptor
17876342 Inter-individual/inter-ethnic variations of docetaxel and doxorubicin pharmacokinetics or pharmacodynamics exist, but genotypic variability of CAR cannot account for this variability.
17876342 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17596880 Role of aryl hydrocarbon receptor in drug metabolism demonstrates in vivo up-regulation of androstane receptor through chemical exposure.
17576804 interindividual variation in the expression level of CAR probably determines variation in expression and activity of a broad scope of xenobiotic metabolism genes
17464991 observations suggest that HNF4alpha1 positively regulates hCAR expression in normal developing and adult livers, whereas HNF4alpha7 represses hCAR gene expression in hepatocellular carcinoma
17276571 hCAR mediates the methotrexate induction of hSULT2A1.
15933212 role in transcriptional regulation of CYP2C8
15919766 there is cross talk between distal CAR/PXR sites and HNF4alpha binding sites in the CYP2C9 promoter and that the HNF4alpha sites are required for maximal induction of the CYP2C9 promoter.
15831521 NR1I3 has a role in regulating both liver homeostasis and tumorigenesis in response to xenobiotic stresses
15572376 studies identified several amino acids within helices 3 (Asn(165)), 5 (Val(199)), 11 (Tyr(326), Ile(330), and Gln(331)), and 12 (Leu(343) and Ile(346)) that contribute to the high basal activity of human CAR
15563456 The two cis-acting elements, the distal PBREM and the proximal OARE, within the chromatin structure are both regulated by CAR in response to okadaic acid and TCPOBOP to maximally induce the CYP2B6 promoter.
15382119 negative regulation of CAR, a glucocorticoid-responsive gene, via proinflammatory cytokine interleukin 1beta (IL-1beta)
15272053 The antiemetic meclizine is both an agonist ligand for mouse CAR and an inverse agonist for human CAR.
15252010 pregnane X receptor (PXR) and constitutively activated receptor (CAR) mediate induction of CYP3A5 in human liver and intestine
15151997 stabilization of helix 12 by a contact between its C terminus and the lysine of helix 4 has the same impact in human and mouse constitutive androstane receptor (CAR)
12896978 CAR-RXR heterodimers and CAR monomers can contribute to the gene activating function of phenobarbital response enhancer modules in CAR target genes
12799447 Alternatively spliced isoforms of the constitutive androstane receptor.
12644704 Induces bilirubin clearance when expressed in transgenic mice
12644700 control of steroid, heme, and carcinogen metabolism by this protein in transgenic mice
12551939 activation requires subnuclear targeting by peroxisome proliferator-activated receptor gamma coactivator-1 alpha
12511605 A distal glucocorticoid response element located within the CAR promoter is described, and evidence is presented that this element is capable of of conferring transcriptional activation via the glucocorticoid pathway.
12485946 Substantial interindividual differences exist in hepatic constitutive androstane receptor expression; a 240-fold interindividual variability in hepatic mRNA levels has been detected.
12376703 identified as a key regulator of acetaminophen metabolism and hepatotoxicity
12181452 Regulation of human CYP2C9 by the constitutive androstane receptor: discovery of a new distal binding site.
12130689 Transcriptional regulation of the human CYP3A4 gene by the constitutive androstane receptor.
12114525 CAR antagonizes ER-mediated transcriptional activity by squelching limiting amounts of p160 coactivators, such as SRC-1 and GRIP-1.

AA Sequence

MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQK      1 - 70
CLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAH     71 - 140
LFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTF    141 - 210
CLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVT    211 - 280
QRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEI    281 - 350
CS                                                                        351 - 352
//

Text Mined References (96)

PMID Year Title
26275810 2015 Genome-wide analysis of human constitutive androstane receptor (CAR) transcriptome in wild-type and CAR-knockout HepaRG cells.
26188155 2015 High resolution melting analysis of the NR1I3 genetic variants: Is there an association with neonatal hyperbilirubinemia?
25835148 2015 Expression of hepatic cytochrome P450s and UDP-glucuronosyltransferases in PXR and CAR double humanized mice treated with rifampicin.
25721668 2015 Protein arginine methyltransferase 5 (PRMT5) is a novel coactivator of constitutive androstane receptor (CAR).
25356900 2015 Combined effects of hepatocyte nuclear factor 4? and constitutive androstane receptor on stable warfarin doses.
25155144 2014 The nuclear receptor constitutive androstane receptor/NR1I3 enhances the profibrotic effects of transforming growth factor ? and contributes to the development of experimental dermal fibrosis.
24859622 2014 Roles of xenobiotic receptors in vascular pathophysiology.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24789201 2014 Coordinated regulation of nuclear receptor CAR by CCRP/DNAJC7, HSP70 and the ubiquitin-proteasome system.
24351870 2014 Association of hemoglobin levels, CYP3A5, and NR1I3 gene polymorphisms with tacrolimus pharmacokinetics in liver transplant patients.
24232815 2013 Influence of PPARA, RXRA, NR1I2 and NR1I3 gene polymorphisms on the lipid-lowering efficacy and safety of statin therapy.
24104474 2013 Gadd45 in the liver: signal transduction and transcriptional mechanisms.
23934188 2014 miR-137 regulates the constitutive androstane receptor and modulates doxorubicin sensitivity in parental and doxorubicin-resistant neuroblastoma cells.
23614276 Expression of nuclear receptors (AhR, PXR, CAR) and transcription factor (Nrf2) in human parotid gland.
23578392 2013 The time point of ?-catenin knockout in hepatocytes determines their response to xenobiotic activation of the constitutive androstane receptor.
23539296 2013 p38 Mitogen-activated protein kinase regulates nuclear receptor CAR that activates the CYP2B6 gene.
23303387 2013 Polymorphisms in regulators of xenobiotic transport and metabolism genes PXR and CAR do not affect multiple myeloma risk: a case-control study in the context of the IMMEnSE consortium.
23172109 2013 Correlates of efavirenz exposure in Chilean patients affected with human immunodeficiency virus reveals a novel association with a polymorphism in the constitutive androstane receptor.
23079705 2013 PPARA, RXRA, NR1I2 and NR1I3 gene polymorphisms and lipid and lipoprotein levels in a Southern Brazilian population.
22978668 2013 The effect of fetal androgen metabolism-related gene variants on external genitalia virilization in congenital adrenal hyperplasia.
22910411 2012 DP97, a DEAD box DNA/RNA helicase, is a target gene-selective co-regulator of the constitutive androstane receptor.
22896671 2012 The orphan nuclear receptor DAX-1 functions as a potent corepressor of the constitutive androstane receptor (NR1I3).
22815988 2012 MicroRNA-122 down-regulation is involved in phenobarbital-mediated activation of the constitutive androstane receptor.
22093699 2012 Transactivation of ABCG2 through a novel cis-element in the distal promoter by constitutive androstane receptor but not pregnane X receptor in human hepatocytes.
21873423 2011 Active ERK1/2 protein interacts with the phosphorylated nuclear constitutive active/androstane receptor (CAR; NR1I3), repressing dephosphorylation and sequestering CAR in the cytoplasm.
21733368 2011 [Expression and clinical significance of constitutive androstane receptor in placental syntrophoblast of intrahepatic cholestasis of pregnancy].
21715435 2011 Cytochrome P450 2B6 (CYP2B6) and constitutive androstane receptor (CAR) polymorphisms are associated with early discontinuation of efavirenz-containing regimens.
21517853 2011 Regulation of P-glycoprotein by orphan nuclear receptors in human brain microvessel endothelial cells.
21415305 2011 Inhibition of human UGT2B7 gene expression in transgenic mice by the constitutive androstane receptor.
21359593 2011 Changes of organic anion transporter MRP4 and related nuclear receptors in human obstructive cholestasis.
21296199 2011 Farnesoid X receptor suppresses constitutive androstane receptor activity at the multidrug resistance protein-4 promoter.
20966044 2011 Cigarette smoke extract induces CYP2B6 through constitutive androstane receptor in hepatocytes.
20622021 2010 CCAAT/enhancer-binding protein alpha (C/EBPalpha) and hepatocyte nuclear factor 4alpha (HNF4alpha) synergistically cooperate with constitutive androstane receptor to transactivate the human cytochrome P450 2B6 (CYP2B6) gene: application to the development of a metabolically competent human hepatic cell model.
20218903 2010 Genetic polymorphisms of CYP1A2, CYP3A4, CYP3A5, pregnane/steroid X receptor and constitutive androstane receptor in 207 healthy Spanish volunteers.
20197307 2010 Effect of oncostatin M on uridine diphosphate-5'-glucuronosyltransferase 1A1 through cross talk with constitutive androstane receptor.
19858220 2009 Dephosphorylation of threonine 38 is required for nuclear translocation and activation of human xenobiotic receptor CAR (NR1I3).
19702932 2009 Association of a single nucleotide polymorphism in the constitutive androstane receptor gene with bone mineral density.
19682433 2010 Constitutive androstane receptor transcriptionally activates human CYP1A1 and CYP1A2 genes through a common regulatory element in the 5'-flanking region.
19302787 2009 Up-regulation of CAR expression through Elk-1 in HepG2 and SW480 cells by serum starvation stress.
19034627 2009 Bioactive terpenoids and flavonoids from Ginkgo biloba extract induce the expression of hepatic drug-metabolizing enzymes through pregnane X receptor, constitutive androstane receptor, and aryl hydrocarbon receptor-mediated pathways.
18713018 2008 Specific inhibition of transcriptional activity of the constitutive androstane receptor (CAR) by the splicing factor SF3a3.
18332083 2008 ATF5 is a highly abundant liver-enriched transcription factor that cooperates with constitutive androstane receptor in the transactivation of CYP2B6: implications in hepatic stress responses.
18331826 2008 Expression of CAR in SW480 and HepG2 cells during G1 is associated with cell proliferation.
18305370 2008 The roles of nuclear receptors CAR and PXR in hepatic energy metabolism.
18303024 2008 Nuclear receptor CAR requires early growth response 1 to activate the human cytochrome P450 2B6 gene.
18294295 2008 Association of genetic polymorphisms in SLCO1B3 and ABCC2 with docetaxel-induced leukopenia.
18202305 2008 PPP1R16A, the membrane subunit of protein phosphatase 1beta, signals nuclear translocation of the nuclear receptor constitutive active/androstane receptor.
18154449 2008 Pharmacogenetics of the constitutive androstane receptor.
18056193 2007 Lack of association of single-nucleotide polymorphisms in pregnane X receptor, hepatic nuclear factor 4alpha, and constitutive androstane receptor with docetaxel pharmacokinetics.
17962186 2007 Induction of nuclear translocation of constitutive androstane receptor by peroxisome proliferator-activated receptor alpha synthetic ligands in mouse liver.
17888866 2007 Regulation of the human cathepsin E gene by the constitutive androstane receptor.
17876342 2008 PXR, CAR and HNF4alpha genotypes and their association with pharmacokinetics and pharmacodynamics of docetaxel and doxorubicin in Asian patients.
17596880 2007 Aryl-hydrocarbon receptor activation regulates constitutive androstane receptor levels in murine and human liver.
17576804 2007 Expression of constitutive androstane receptor, hepatic nuclear factor 4 alpha, and P450 oxidoreductase genes determines interindividual variability in basal expression and activity of a broad scope of xenobiotic metabolism genes in the human liver.
17464991 2007 Differential regulation of constitutive androstane receptor expression by hepatocyte nuclear factor4alpha isoforms.
17276571 2007 Human constitutive androstane receptor mediated methotrexate induction of human dehydroepiandrosterone sulfotransferase (hSULT2A1).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16554032 2006 PRIC320, a transcription coactivator, isolated from peroxisome proliferator-binding protein complex.
15933212 2005 Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha.
15919766 2005 The nuclear receptors constitutive androstane receptor and pregnane X receptor cross-talk with hepatic nuclear factor 4alpha to synergistically activate the human CYP2C9 promoter.
15831521 2005 Xenobiotic stress induces hepatomegaly and liver tumors via the nuclear receptor constitutive androstane receptor.
15618763 2003 Twenty-six novel single nucleotide polymorphisms and their frequencies of the NR1I3 (CAR) gene in a Japanese population.
15610735 2004 A structural basis for constitutive activity in the human CAR/RXRalpha heterodimer.
15572376 2005 Amino acids important for ligand specificity of the human constitutive androstane receptor.
15563456 2005 Novel CAR-mediated mechanism for synergistic activation of two distinct elements within the human cytochrome P450 2B6 gene in HepG2 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15382119 2004 Interleukin 1beta inhibits CAR-induced expression of hepatic genes involved in drug and bilirubin clearance.
15272053 2004 Meclizine is an agonist ligand for mouse constitutive androstane receptor (CAR) and an inverse agonist for human CAR.
15252010 2004 The induction of cytochrome P450 3A5 (CYP3A5) in the human liver and intestine is mediated by the xenobiotic sensors pregnane X receptor (PXR) and constitutively activated receptor (CAR).
15194709 2004 Expression of constitutive androstane receptor splice variants in human tissues and their functional consequences.
15151997 2004 Agonist-dependent and agonist-independent transactivations of the human constitutive androstane receptor are modulated by specific amino acid pairs.
14573755 2003 Cytoplasmic accumulation of the nuclear receptor CAR by a tetratricopeptide repeat protein in HepG2 cells.
14567971 Alternative splicing within the ligand binding domain of the human constitutive androstane receptor.
12896978 2003 Characterization of DNA complexes formed by the nuclear receptor constitutive androstane receptor.
12799447 2003 Alternatively spliced isoforms of the human constitutive androstane receptor.
12644704 2003 Induction of bilirubin clearance by the constitutive androstane receptor (CAR).
12644700 2003 Control of steroid, heme, and carcinogen metabolism by nuclear pregnane X receptor and constitutive androstane receptor.
12611900 2003 Identification of a novel human constitutive androstane receptor (CAR) agonist and its use in the identification of CAR target genes.
12551939 2003 Activation of orphan nuclear constitutive androstane receptor requires subnuclear targeting by peroxisome proliferator-activated receptor gamma coactivator-1 alpha. A possible link between xenobiotic response and nutritional state.
12511605 2003 Transcriptional analysis of the orphan nuclear receptor constitutive androstane receptor (NR1I3) gene promoter: identification of a distal glucocorticoid response element.
12485946 2003 Constitutive androstane receptor and pregnane X receptor gene expression in human liver: interindividual variability and correlation with CYP2B6 mRNA levels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376703 2002 Modulation of acetaminophen-induced hepatotoxicity by the xenobiotic receptor CAR.
12181452 2002 Regulation of human CYP2C9 by the constitutive androstane receptor: discovery of a new distal binding site.
12130689 2002 Transcriptional regulation of the human CYP3A4 gene by the constitutive androstane receptor.
12114525 2002 Inhibitory cross-talk between estrogen receptor (ER) and constitutively activated androstane receptor (CAR). CAR inhibits ER-mediated signaling pathway by squelching p160 coactivators.
11891224 2002 Cross-repression, a functional consequence of the physical interaction of non-liganded nuclear receptors and POU domain transcription factors.
11114890 2000 Reciprocal activation of xenobiotic response genes by nuclear receptors SXR/PXR and CAR.
9783588 1998 Androstane metabolites bind to and deactivate the nuclear receptor CAR-beta.
9773978 1998 Inhibition of estrogen receptor action by the orphan receptor SHP (short heterodimer partner).
9295294 1997 Differential transactivation by two isoforms of the orphan nuclear hormone receptor CAR.
8650544 1996 An orphan nuclear hormone receptor that lacks a DNA binding domain and heterodimerizes with other receptors.
8603043 1996 A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily.
8114692 1994 A new orphan member of the nuclear hormone receptor superfamily that interacts with a subset of retinoic acid response elements.