Property Summary

Ligand Count 25
NCBI Gene PubMed Count 306
PubMed Score 1582.60
PubTator Score 825.97

Knowledge Summary

Patent (121,238)

TINX Plot

  Disease (6)

Expression

PDB (21)

Gene RIF (313)

AA Sequence

MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMK      1 - 70
RNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGV     71 - 140
QGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLK    141 - 210
VSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAA    211 - 280
FELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFS    281 - 350
PDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF    351 - 420
ATPLMQELFGITGS                                                            421 - 434
//

Text Mined References (309)

PMID Year Title