Property Summary

Ligand Count 158
NCBI Gene PubMed Count 218
PubMed Score 350.32
PubTator Score 566.77

Knowledge Summary

Patent (58,079)

TINX Plot

  Disease (8)

Expression

 GWAS Trait (1)

Protein-protein Interaction (1)

PDB (66)

Gene RIF (181)

AA Sequence

MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ      1 - 70
ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVC     71 - 140
GDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECMYTG    141 - 210
LLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMP    211 - 280
QEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIF    281 - 350
NKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK    351 - 420
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ        421 - 486
//

Text Mined References (236)

PMID Year Title