Property Summary

Ligand Count 158
NCBI Gene PubMed Count 218
PubMed Score 350.32
PubTator Score 566.77

Knowledge Summary

Patent (58,079)

TINX Plot

  Disease (8)

Expression

Synonym

Accession Q96RI1 A1L4K5 B7Z412 B7ZM06 F8VYG8 Q8NFP5 Q8NFP6 Q92943
Symbols BAR
FXR
HRR1
HRR-1
PFIC5
RIP14

Gene

 GWAS Trait (1)

Protein-protein Interaction (1)

PDB (66)

Gene RIF (181)

AA Sequence

MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ      1 - 70
ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVC     71 - 140
GDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECMYTG    141 - 210
LLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMP    211 - 280
QEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIF    281 - 350
NKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK    351 - 420
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ        421 - 486
//

Text Mined References (236)

PMID Year Title