Property Summary

NCBI Gene PubMed Count 234
PubMed Score 115.46
PubTator Score 299.79

Knowledge Summary

Patent (6,521)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.400 3.5e-06
psoriasis -1.500 2.5e-04
osteosarcoma -1.876 8.9e-03
adrenocortical carcinoma -1.250 3.1e-03
tuberculosis 1.100 9.7e-04
active Crohn's disease -1.493 3.1e-03
active ulcerative colitis -1.109 7.0e-03
ductal carcinoma in situ -1.100 1.7e-02
invasive ductal carcinoma -1.200 1.1e-02
head and neck cancer and chronic obstruc... 1.100 2.1e-04

Protein-protein Interaction (6)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (206)

PMID Text
26814197 these data identify a new mechanism of LXR regulation that involves TIPARP, ADP-ribosylation and MACROD1.
26692490 In conclusion, our data indicate that HNF-4alpha may have a wider role in cell and plasma cholesterol homeostasis by controlling the expression of LXRalpha in hepatic cells.
26669941 LXR-alpha might downregulate S1PR2 expression via miR-130a-3p in quiescent HUVECs. Stimulation of TNF-alpha attenuates the activity of LXR-alpha and results in enhanced S1PR2 expression.
26602218 Intestinal activation of LXR reduces the production of chylomicrons by a mechanism dependent on the apical localization of SR-B1.
26595172 Studied the role of LXRalpha with Wnt/beta-catenin signaling in adipogenesis of MSCs.
26469385 HIV-1 MA activates NR1H3 signaling in primary hepatocytes
26379423 Suggest that blocking cholesterol deposition and inhibiting the LXRalpha pathway-induced inflammatory response might be one of the main mechanisms by which anthocyanins exert their protective effects in diabetic nephropathy.
26261553 Lipoxin A4 increases ABCA1 expression and promotes cholesterol efflux through LXRalpha pathway in THP-1 macrophage-derived foam cells.
26160456 These results identify LXRalpha as a key cardiac transcriptional regulator that helps orchestrate an adaptive metabolic response to chronic cardiac stress.
25980575 This study provides the first evidence to show LXR activation reduces cadmium-induced apoptotic cell death of human renal proximal tubular cells by inhibition of reactive oxygen species production and JNK activation.
25962847 Data show that menin, encoded by the MEN1 gene, inhibits the transcriptional activity of nuclear receptor liver X receptor alpha (LXRalpha).
25867319 The rs12221497 polymorphism in the LXRalpha gene was associated with the susceptibility to stroke in a Han Chinese population.
25779847 treatment with Ang-(1-7) promoted cholesterol efflux in Ang II-treated THP-1 macrophages, partly through inactivation of p38 and JNK signaling and by inducing the expression of PPARg and LXRa.
25729942 the rsl2221497 polymorphism in the LXRalphagene was associated with the susceptibility to stroke in a Chinese population.
25661920 These results clearly indicate a novel mechanism in which CCAR2 may regulate the transcriptional activation function of LXRalpha due to its specific inhibition of SIRT1 and serve to regulate cellular proliferation.
25659329 LXRb is the dominant isoform in the rat myocardium and the expression of both LXR isoforms (LXRa and LXRb) did not change after administration of T0901317
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPARgamma/LXRalpha pathway in THP-1 macrophage-derived foam cells.
25437875 TRAP80 is a selective regulator of hepatic lipogenesis and is required for LXR-dependent SREBP-1c activation.
25332231 FHL2 is a transcriptional coactivator of LXRs and may be an important determinant of cholesterol metabolism in SMCs
25283515 An increase of 55% in LXR-alpha gene expression at RNA level was observed in Atorvastatin + 22-R hydroxycholestrol compared to 24% in Ascorbic acid + 22-ROH cholesterol.
25264165 The data indicate a direct inhibitory interaction of polyunsaturated fatty acids with LXRalpha, a consequent reduction of SREBP-1 and of its binding to SCD1 promoter.
25255963 ligands selectively regulate placenta gene targets and functional pathways
25187371 PRMT3 translocation by palmitic acid is coupled to the binding of LXRalpha, which is responsible for the onset of fatty liver.
25102981 This research suggests that LXR is an attractive target for treatment and regulation of hepatic inflammation and fibrosis.
25073010 NR1H3 accelerates hepatic differentiation through an HNF4alpha-dependent reciprocal network.
25035925 study suggests that the anti-atherogenic properties of IL-10 may include enhancing effects on cholesterol efflux mechanism that involves cross-talk with LXRalpha activation
25028566 The expression of liver X receptor alpha is a potential predictor for the expression of hydroxysteroid sulfotransferase 2a1 in human liver.
25005769 SREBP-2 rs2228314 G to C change and variant C genotype as well as LXRalpha rs11039155 G to A change and variant A may contribute to PCOS in Chinese Han population
24996838 LXRalpha rather than LXRbeta plays a predominant role in mediating cholesterol efflux in human macrophages.
24886807 Data indicata that -1830 T>C polymorphism within liver X receptors alpha gene (NR1H3) promoter region may be involved in regulation of NR1H3 expression.
24842676 Report significant reduction in LXR-alpha transcript in testes of men with azoospermia.
24832115 Studies indicate that no liver X receptor (LXR) modulator has successfully progressed beyond phase I clinical trials.
24751522 PPARgamma negatively regulates the expression of miR-613 at transcriptional level, and miR-613 suppressed LXRalpha and ABCA1 by targeting the 3'-UTR of their mRNAs.
24713062 PPARalpha and LXRalpha interact with high affinity, resulting in altered protein conformations, the affinity of this interaction and the resulting conformational changes could be altered by endogenous PPARalpha ligands, namely long chain fatty acids.
24618263 Activation of LXRs interfered with the release of interleukin-6 from macrophages and, thus, inhibited fibroblast activation and collagen release.
24533572 The rsl2221497 polymorphism in LXRalpha gene is associated with susceptibility of coronary heart disease in Han population.
24289152 Data suggest PAF (platelet activating factor)/PAF receptor signaling exerts proinflammatory effect on neutrophil via downregulation of LXRa/target genes (ATP-binding cassette transporter (ABC) A1, ABC G1, sterol response element binding protein 1c).
24278306 genetic variation in NR1H3 modulates the expression of LXRalpha and the levels of soluble Abeta42.
24265317 Results indicate that Ursodeoxycholic acid (UDCA) activates SMILE gene expression, which leads to repression of liver X receptor alpha (LXRalpha)-mediated hepatic lipogenic enzyme gene expression.
24180251 There was no significant association between two NR1H3 single nucleotide polymorphisms and obesity, even after adjustment for age and sex. The odds ratios for obesity were: 1.32 (0.85-2.74) for rs11039155 and 0.77 (0.30-1.99) for rs2279238.
24118845 The liver X receptor activation has anti-inflammatory effects on CXC10, CCL5 and IL-10 production from alveolar macrophages.
24100084 Variants in LXRalpha and LXRbeta genes are not potential contributors to the risk of metabolic syndrome and related traits in an Iranian population.
24036496 Liver X receptor activation stimulates iron export in human alternative macrophages.
23867395 LXRalpha activates FoxO1 transcription through a direct binding on its promoter region.
23838803 Data indicate that LXR-beta genotypes (rs35463555) and (rs2695121) were associated with risk of gallbladder cancer (GBC) as compared to healthy controls whereas LXR-alpha (rs7120118) was not associated with GBC risk.
23812424 LXRalpha-mediated downregulation of FOXM1 suppresses the proliferation of hepatocellular carcinoma cells.
23733886 evidence for the existence of an LXR-IDOL-mediated internalization pathway for the LDLR that is distinct from that used for lipoprotein uptake
23732298 Liver x receptor alpha positively regulates the basal expression of CYP3A4 in hepatocytes.
23686114 Treatment of human THP-1 macrophages with endogenous or synthetic LXR ligands stimulates both transcriptional and posttranscriptional pathways that result in the selective recruitment of the LXRalpha subtype to LXR-regulated promoters.
23680128 PGC-1b, a coactivator of both LXR-alpha and SREBP-1, was markedly down-regulated by OEPAs compared with EPA.
23564066 LXRalpha plays a central role in neopterin-induced downregulation of ABCA1 and ABCG1 in THP-1 macrophage-derived foam cells.
23496987 MiR-613 suppresses lipogenesis by directly targeting LXRalpha in HepG2 cells.
23451202 STX4 is a new LXRalpha-ligand to study transcriptional regulation of anti-atherogenic processes in cell or ex vivo models, and provides a promising lead structure for pharmaceutical development
23416078 TR-beta and LXR-alpha competitively up-regulate the human Seladin-1 promoter, sharing the same response element, site A.
23393188 The study identified highly integrated LXRalpha ligand-dependent transcriptional networks, including the APOE/C1/C4/C2-gene cluster, which contribute to the reversal of cholesterol efflux and the dampening of inflammation processes in foam cells to prevent atherogenesis.
23313547 LXRalpha levels appear as a limiting factor for macrophage cholesterol efflux in humans.
23185273 Three new cell surface markers that could be useful to monitor LXR activation, were identified.
23163651 Higher expression of LXR-alpha in perilesional melanocytes decreases adhesion, proliferation, and matrix metalloproteinases, and increases apoptosis leading to vitiligo lesions.
23099324 activation of the LXR could have a beneficial, therapeutic effect in the prevention of bacterial-induced bone erosion
23041609 LXRalpha transactivates the expression of CYP1A1 and CYP1A2 through common two cis-elements
23018104 Activation of LXR reduced the binding of the transcriptional factors AP-1 and NF-kappaB to the ET-1 gene promoter region, thereby regulating gene expression.
22990668 Activation of LXRalpha during inflammatory response may constitute an endogenous protective mechanism in rheumatoid arthritis fibroblast-like synoviocytes.
22984430 The regulation of SREBP-1c gene expression by SIRT1 may require the deacetylation of LXR transcription factors.
22916038 An allele-specific regulatory polymorphism within NR1H3 (coding for LXR-a), rs7120118, coincides with causal SNPs for HDL-C levels associated with cardiovascular disease in Caucasian patients.
22766509 Discussion of the role of LXR in orchestrating lipid homeostasis and neuroinflammation in the brain. The ability of LXR to attenuate Alzheimer disease pathology makes them potential therapeutic targets for this neurodegenerative disease. [Review Article]
22749359 The induction of ABCG1 and its mediated 7-ketocholesterol efflux from endothelial cells by cyanidin-3-O-beta-glucoside resulted from liver X receptor alpha activation.
22723445 Pharmacological activation of endothelial LXRs reduces angiogenesis by restraining cholesterol-dependent vascular endothelial growth factor receptor-2 compartmentation and signaling.
22707265 Data suggest that taurine, a dietary component, is a direct ligand of LXR-alpha and appears to control gene expression of LXR-alpha and it's responsive genes (e.g., ATP-binding cassette transporters) in enterocytes, macrophages, and hepatocytes.
22641099 Studied the effect of HCV NS5A protein, core protein, and viral replication on the intracellular lipid accumulation and the LXRalpha-regulated expression of lipogenic genes.
22634718 Liver X receptor regulates rheumatoid arthritis fibroblast-like synoviocyte invasiveness, matrix metalloproteinase 2 activation, interleukin-6 and CXCL10.
22610535 Activation of LXR-alpha and LXR-beta Suppresses Proliferation of Human Colon Cancer Cells.
22569763 serum LXRa ligand oxysterol levels could be surrogate markers of insulin resistance, and high oxysterol levels in the circulation may play an important role in the development of hepatic and peripheral insulin resistance followed by NAFLD
22547570 Lxralpha regulates the androgen response in prostate epithelium
22503545 PAPP-A may first down-regulate expression of LXRalpha through the IGF-1/PI3-K/Akt signaling pathway and then decrease expression of ABCA1, ABCG1, SR-B1 and cholesterol efflux in THP-1 macrophage-derived foam cells.
22399489 Regulation of LXRalpha pre-mRNA splicing may be involved in the pathogenesis of LXRalpha-related diseases
22367754 liver x receptors are activated by phospholipase A2 modified low density lipoproteins in human macrophages
22311022 Two genetic variants in LXRalpha independently influence the susceptibility to metabolic risk factors of polycystic ovary syndrome patients.
22257474 LXR are involved in the metabolism and inflammation in human diseases; nonalcoholic fatty liver disease (NAFLD) is classically associated with lipid metabolic disorders and inflammatory responses.
22137263 Data suggest that expression of LXRalpha in androgen-independent prostate neoplasm cells can be regulated by dietary factors (here, the carotenoid lycopene).
22027013 Te results of this study suggested taht genetic variations in MMEL1, ECE1, ECE2, AGER, PLG, PLAT, NR1H3, MMP3, LRP1, TTR, NR1H2, and MMP9 genes do not play major role among the Finnish AD patient cohort.
21951066 LXR alpha/beta play a role in the regulation of tyrosine hydroxylase and alpha-synuclein expression; the extent to which the oxysterol 27-hydroxycholesterol utilizes these pathways to modulate expression levels of these two proteins is characterized.
21937108 RXRalpha and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21903943 Functional genetic variation in liver X receptor alpha (LXRalpha) predicts risk of ischemic vascular disease in the general population.
21889884 FGF21 gene expression was negatively regulated by LXR in HepG2 cells and mouse primary hepatocytes.
21775116 The mRNA levels of LXRalpha and SREBP-1c, transcription factors that regulate SCD-1, were decreased by 10,12 conjugated linoleic acid in human adipocytes.
21625070 decreased expression in atherosclerotic artery macrophages infected with Chlamydia pneumoniae
21562465 LXRA genotypes were associated with variable risk for cardiovascular outcomes and pharmacogenetic effect.
21440016 This increase in hepatitis B virus transcription and replication was directed by nuclear receptor LXRalpha induction in the presence of oxysterols.
21356276 we concluded that LXR-alpha/beta gene expression ratio is a critical factor to activate POMC gene expression in ACTH-secreting pituitary adenomas.
21350215 Different regulatory activities of the liver X receptoralpha (and PPARgamma) pathways identified a distinct macrophage subpopulation with a low susceptibility to become foam cells.
21349840 Liver X receptor-retinoid X receptor (LXR-RXR) heterodimer cistrome reveals coordination of LXR and AP1 signaling in keratinocytes
21316679 Genetic polymorphisms in NR1H3 and its target genes ABCA1, APOE, CETP and LPL contribute to the genetic variance for HDL-cholesterol concentrations in adolescence.
21315073 CIDEA binds to liver X receptors and regulates their activity in vitro.
21310851 the expression of hsa-miR-613 can be transcriptionally activated by LXR-alpha
21266776 This study reports a novel signaling pathway underlying liver X receptor-mediated regulation of Th17 cell differentiation and autoimmunity.
21245992 PXR and LXR polymorphisms, but not NF-kB or PPARgamma, may contribute to risk of IBD, especially among never smokers
21187453 an important role of LXRs in the coordinated regulation of lipid metabolic and inflammatory gene programs in macrophages
21136146 elevated expression of LXRalpha may be involved in the progression of diabetic cardiomyopathy, and demethylation of LXRalpha is likely to be responsible for its increased expression in myocardial tissues.
21125317 the Liver X Receptor-alpha gene activated in cancerous cells of diverse origin results in the regulation of genes forcing these cells to enter into the state of apoptosis
21042792 Observational study of gene-disease association. (HuGE Navigator)
20945144 Data suggest LXRalpha has a role in regulation of lipid synthesis in keratinocytes; activation of LXRalpha via a ligand leads to accumulation of lipid droplets and increases expression of SREBP-1c, FAS, PPARalpha, PPARbeta, and PPARgamma.
20868688 Data suggest the ability of FoxO1 to inhibit LXRalpha binding with the LXRE in the SREBP-1c promoter.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20837115 Results establish for the first time that LPCAT3 is specifically regulated by LXRalpha.
20836841 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20655109 Gene expression of LXRalpha was significantly decreased in placental tissues, while increased expression was observed for LXRalpha in adipose tissue, from pregnancies complicated by preeclampsia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20506155 Data suggest that berberine abrogates the formation of foam cells by macrophages by enhancing LXRalpha-ABCA1-dependent cholesterol efflux.
20494359 Indicate that LXRalpha has an essential role in the regulation of CETP expression and maintaining reverse cholesterol transport.
20410489 Activation of LXR alpha represents a novel lipid-signaling paradigm that alters the inflammatory response of human dendritic cells.
20364260 LXR activation inhibits chemokine-induced migration of CD4-positive lymphocytes by reducing PI-3 kinase activity and activation of Rac-1 with subsequent inhibition of MLC phosphorylation, f-actin formation and ICAM3 translocation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219900 Results suggest that liver X receptors play a regulatory role in fatty acid metabolism by direct regulation of ACSL3 in human placental trophoblast cells.
20190811 Liver X Receptor activation downregulates AKT survival signaling in lipid rafts and induces apoptosis of prostate cancer cells.
20139031 Data clarified the PAR-2 expression of human macrophages and suggested that tryptase might promote lipid accumulation in macrophages and foam cell formation by suppressing LXRalpha activation via PAR-2/LXRalpha/LXRalpha target genes signaling pathway.
20118482 activation of LXRalpha stimulates renin expression and induces mesenchymal stem cell differentiation into renin-secreting, juxtaglomerular-like cells
20080977 DAX-1 acts as a novel corepressor of liver X receptor alpha and inhibits hepatic lipogenesis
20057170 results provide evidence that TGF-beta1 up-regulates expressions of ABCA1, ABCG1 and SR-BI through the LXR alpha pathway in THP-1 macrophage-derived foam cells
20037595 production in tumors inhibits functional expression of CCR7 in dendritic cells and dampens antitumor responses
20005944 sauchinone has the capability to inhibit LXRalpha-mediated SREBP-1c induction and SREBP-1c-dependent hepatic steatosis
19933273 O-GlcNAcylation of LXR is a novel mechanism by which LXR acts as a glucose sensor affecting LXR-dependent gene expression, substantiating the crucial role of LXR as a nutritional sensor in lipid and glucose metabolism.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837721 LXRalpha and LXRbeta control cholesterol homeostasis.
19798078 LXR-alpha gene knockdown within normal human keratinocytes simulated the genomic profile observed in psoriatic skin lesions.
19796621 Deletion of liver X receptors (Lxralpha and beta) reduced cell cycle progression and ventral midbrain neurogenesis, resulting in decreased dopaminergic neurons at birth.
19697157 LXRbeta protein expression was unaltered in photoaged skin (p = 0.75). Our data therefore suggest that, while not playing a major role in skin aging, robust cutaneous expression implies a fundamental role for LXRbeta in epidermal biology.
19645823 The expression of LXR-alpha at both mRNA and protein level was significantly higher in perilesional skin as compared to the normal skin of vitiligo patients.
19481530 Data describe the requirement of GPS2 for ABCG1 gene transcription and cholesterol efflux from macrophages, and implicate GPS2 in facilitating LXRalpha/beta recruitment to an ABCG1-specific promoter/enhancer unit upon ligand activation.
19426978 LXR-activating oxysterols induce the expression of inflammatory markers in endothelial cells through LXR-independent mechanisms.
19380774 Liver X receptors alpha and beta are constitutively expressed and functional in human B cells.
19366697 A mechanism for LXRalpha in controlling the gene expression of LGK that involves activation through SREBP-1c and PPARgamma and inhibition through SHP, is proposed.
19360318 Cholesterol synthesis was activated in NAFLD liver, meaning that cholesterol metabolism is dysregulated in non-alcoholic fatty liver disease.
19292929 Common genetic variation in LXRA is unlikely to affect the risk of developing type 2 diabetes or quantitative phenotypes related to glucose homeostasis
19292929 Observational study of gene-disease association. (HuGE Navigator)
19261092 the inhibitory activity of liver X receptor alpha, ATP-binding cassette transporter and macrophage scavenger receptor A by LPS may be related to the transformation of human macrophages into foam cells.
19211025 The present study was directed to explore the functional genomics of LXR-alpha gene within blood mononuclear cells of subjects suffering from coronary heart disease (CHD).
19201410 PPARg, PPARd and LXRa are involved in the regulation of ABCA1 expression and HDL biogenesis in a cooperative signal transduction pathway
19164445 Data suggest that LXR ligands prevent LXRalpha from ubiquitination and degradation by detaching BARD1/BRCA1, which may be critical for early transactivation of ligand-stimulated LXRalpha through binding of LXRalpha to the promoters of target genes.
19119143 Suppression of 2,3-oxidosqualene cyclase by high fat diet contributes to liver X receptor-alpha-mediated improvement of hepatic lipid profile.
19105208 mediates HBV-associated hepatic steatosis
19060910 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854425 25-Hydroxycholesterol-3-sulfate regulates macrophage lipid metabolism via the LXR/SREBP-1 signaling pathway.
18789440 IFN-gamma down-regulates ABCA1 expression by inhibiting LXRalpha in a JAK/STAT signaling pathway-dependent manner
18669643 Data show that, at sufficiently high concentration, the NR corepressor (NCoR) influences the activity of the liver X receptor (LXR) even in the presence of a potent full agonist that destabilizes NCoR binding.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18562803 FXRalpha down-regulates CETP gene expression via binding to the DR4RE sequence within the CETP 5' promoter and this FXRalpha binding is essential for FXRalpha inhibition of LXRalpha-induced CETP expression.
18511497 These data identify Rev-erbalpha as a new LXR target gene, inhibiting LXR-induction of TLR-4 in a negative transcriptional feedback loop, but not cholesterol homeostasis gene expression.
18372238 Protein kinase C alpha modulates liver X receptor alpha transactivation.
18327405 CRP modulates the expression of genes that contribute to both pro- and anti-inflammatory responses in human monocytes. Among these novel anti-inflammatory effects, we show clearly that CRP activates the LXRalpha pathway.
18276933 LXR (as a heterodimer with the retinoid X receptor) is able to bind the ENG promoter on an LXR response element and mediates the activation of ENG gene expression by LXRalpha in JAR cells.
18250151 reveal a previously unrecognized role for phosphorylation in restricting the repertoire of LXRalpha-responsive genes
18209740 results suggest that NR1H3 plays an important role in the HDL-cholesterol metabolism and in the genetic susceptibility to metabolic syndrome.
18209740 Observational study of gene-disease association. (HuGE Navigator)
18182682 review of role of activation of PPARalpha, -beta/delta, or -gamma or LXRs in skin physiology and cytology and disease
18096827 Laminar flow increases LXR function via a PPARgamma-CYP27 dependent mechanism, which reveals an atheroprotective role for laminar flow exerting on endothelium.
18024509 May modulate the bile acid biosynthetic pathway at a unique site downstream of cholesterol 7-alpha- ydroxylase (CYP7A1) and 3 alpha-hydroxysteroid dehydrogenase (AKR1C4) and may also modulate the metabolism of steroid hormones and certain xenobiotics.
18007013 Upregulation of ABCG5/ABCG8 in gallstone patients, possibly mediated by increased liver X receptor (LXR) alpha, may contribute to the cholesterol supersaturation of bile, a prerequisite for gallstone formation.
17960176 important roles of LXRalpha in differentiation and inflammatory signaling in sebaceous glands
17845217 LXRalpha and LXRbeta are expresed in the majority of the cell types in human skin.
17766241 In summary, this study is the first to demonstrate anti-inflammatory actions of LXRs in the lung.
17724434 It was proposed that LXR is a key regulator of cytokine release in LPS-challenged human monocytes, possibly by interfering with translational events.
17644777 atorvastatin reduces LPL and EL expression by reducing the activation of LXRalpha and NF-kappaB, respectively
17628006 This novel insight that thyroid hormone regulates LXR-alpha mRNA levels and promoter activity should shed light on a cross talk between LXR-alpha and TR-beta1 as a new therapeutic target against dyslipidemia and atherosclerosis.
17452725 Haplotype 2 associated with reduced mortality from infectious disease. Haplotype 2 also associated with higher levels of plasma apolipoprotein E, a target gene of the LXRalpha (p =.018), and higher levels of triglycerides (p =.041).
17416342 The LXR agonist T0901317, therefore, acts as an antiandrogen in human prostate cancer cells.
17405904 We show here that primary hASM cells express liver X receptor (LXR; alpha and beta subtypes), an oxysterol-activated nuclear receptor that controls expression of genes involved in lipid and cholesterol homeostasis, and inflammation.
17396233 These data indicate for the first time that human macrophage aP2 promoter is a direct target for the regulation by LXR/RXR heterodimers.
17391100 Results suggest that co-repression of LXR activity by RIP140 involves an atypical binding mode of RIP140 and a repression element in the RIP140 C-terminus.
17296605 LXRalpha is regulated not only by oxysterol derivatives but also by PKA-mediated phosphorylation, which suggests that nutritional regulation of SREBP-1c and lipogenesis could be regulated at least partially through modulation of LXR
17272748 Observational study of gene-disease association. (HuGE Navigator)
17255360 LXR is a potent modulator of dendritic cells maturation and function mediated in part by blocking the expression of fascin.
17218271 These studies define parallel but functionally distinct pathways that are utilized by PPARgamma and LXRs to differentially regulate complex programs of gene expression that control immunity and homeostasis.
17217555 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17135302 ROS and NF-kappaB, but not LXR, mediate the IL-1beta-induced downregulation of ABCA1 via a novel transcriptional mechanism, which might play an important role of proinflammation in the alteration of lipid metabolism.
17110595 novel mechanism of inflammatory gene regulation (C-reactive protein) by LXR ligands
17108812 One LXRA single nucleotide polymorphism, rs2279238, and one common haplotype, CAAGCC, as well as two LXRB single nucleotide polymorphisms, LB44732G>A and rs2695121, were associated with obesity phenotypes.
16973760 LXR-alpha and LXR-beta independently interfere with the hypothalamic-pituitary-adrenal axis regulation at the level of the pituitary and the adrenal gland
16956579 myeloperoxidase is regulated by LXR and PPARalpha ligands
16941683 Observational study of gene-disease association. (HuGE Navigator)
16941683 in the investigated German sample, no evidence of association of ABCB11 and LXRA to gallstone susceptibility was detected. The gallstone trait is not allelic to progressive familial cholestasis at the ABCB11 locus.
16920108 Data show that liver X receptor alpha regulates the low-density lipoprotein receptor gene, which mediates the endocytic uptake of LDL cholesterol in the liver.
16904112 Results provide evidence that liver X receptors alpha and beta are phosphorylated proteins.
16758300 LXR-alpha gene plays a crucial role in the regulation of innate immunity at the genomic level.
16567856 Data demonstrate that LXR-alpha activation altered all of the cellular cholesterol fluxes.
16482468 LXR agonists may lead to increased utilisation of lipids and glucose in muscle cells without affecting the mechanism of action of insulin.
16354658 competitive binding of coactivators and corepressors can explain the tissue-specific behavior of partial liver X receptor alpha and beta agonists
16249184 LXRalpha is a negative modulator of Abcd2, acting through a novel regulatory mechanism involving overlapping SREBP and LXRalpha binding sites
16170053 expression of alternative LXRalpha transcripts in certain biological contexts may impact LXR signaling and lipid metabolism
16106051 liver X receptor-alpha in mouse kidney and HK-2 proximal tubular cells is downregulated by LPS and cytokines
16054077 The beneficial effect of hepatic LXRalpha was abrogated by a synthetic LXR agonist, which activated SREBP-1c and its target genes.
15625283 In the human body, the LXRalpha protein is highly expressed in macrophage lineage cells and foam cells in atherosclerotic lesions
15548517 activation of the liver X receptors (LXR) dramatically promoted lipid accumulation in vascular smooth muscle cells
15539633 LXRs are expressed and functional in primary human coronary artery smooth muscle cells; their ligands inhibit cell proliferation and neointima formation
15353176 LXRalpha plays an important role in the cAMP-mediated regulation of human renin gene transcription by binding to cAMP responsive element in the promoter.
15319359 unliganded TRbeta1 suppresses promoter activity driven by LXRalpha and its ligand, whereas transactivation by T3-bound TRbeta1 is not affected by LXRalpha in the presence or absence of oxysterols
14699103 LXRalpha and LXRbeta regulate transcription of the vascular endothelial growth factor gene in macrophages
12957674 hLXRalpha and hLXRgeta transactivated a reporter gene bearing a truncated FPPS promoter containing a putative direct repeat 4 (DR4) LXR response element, and direct interaction was demonstrated
12932788 These data enable the identification of the amino acids that coordinate the interaction of both steroidal and non-steroidal ligands in the ligand-binding pocket of liver X receptor alpha.
12470296 PGC-1 alpha serves as a co-activator for the liver X receptor (LXR) alpha
12198243 SHP is able to interact with LXR and to modulate its transcriptional activity.
12161442 LXRa is regulated by fatty acids in human cells
12117567 interaction of peroxisome proliferator-activated receptor alpha with liver X receptor alpha antagonizes the stimulatory effect of their respective ligands on the murine cholesterol 7alpha-hydroxylase gene promoter
12054659 Different regulation of the LXRalpha promoter activity by isoforms of CCAAT/enhancer-binding proteins
12032151 studies demonstrate that activated LXR induces the expression of the apoE/C-I/C-IV/C-II gene cluster in both human and murine macrophages
11875109 data suggest a model in which LXR ligands trigger an autoregulatory loop leading to selective induction of hLXRalpha gene expression

AA Sequence

MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRA      1 - 70
EPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHC     71 - 140
PMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ    141 - 210
LGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ    211 - 280
LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ    281 - 350
LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV    351 - 420
HSEQVFALRLQDKKLPPLLSEIWDVHE                                               421 - 447
//

Text Mined References (235)

PMID Year Title
26814197 2016 TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.
26692490 2016 Transcriptional regulation of the human Liver X Receptor ? gene by Hepatocyte Nuclear Factor 4?.
26669941 2016 Liver X receptor-? and miR-130a-3p regulate expression of sphingosine 1-phosphate receptor 2 in human umbilical vein endothelial cells.
26602218 2016 Liver X Receptor Regulates Triglyceride Absorption Through Intestinal Down-regulation of Scavenger Receptor Class B, Type 1.
26595172 2016 Nuclear hormone receptor LXR? inhibits adipocyte differentiation of mesenchymal stem cells with Wnt/beta-catenin signaling.
26379423 2015 Anthocyanins inhibit high-glucose-induced cholesterol accumulation and inflammation by activating LXR? pathway in HK-2 cells.
26261553 2015 Lipoxin A4 promotes ABCA1 expression and cholesterol efflux through the LXR? signaling pathway in THP-1 macrophage-derived foam cells.
26160456 2015 Cardiac LXR? protects against pathological cardiac hypertrophy and dysfunction by enhancing glucose uptake and utilization.
26120082 2015 Broad Anti-tumor Activity of a Small Molecule that Selectively Targets the Warburg Effect and Lipogenesis.
25980575 2015 Activation of liver X receptors inhibits cadmium-induced apoptosis of human renal proximal tubular cells.
25962847 2015 Tumor suppressor Menin acts as a corepressor of LXR? to inhibit hepatic lipogenesis.
25867319 2015 Association between the LXR? polymorphism and stroke in a Chinese population.
25779847 2015 Angiotensin-(1-7) stimulates cholesterol efflux from angiotensin II-treated cholesterol-loaded THP-1 macrophages through the suppression of p38 and c-Jun N-terminal kinase signaling.
25729942 2015 Association of liver X receptor ? (LXR?) gene polymorphism and ischemic stroke.
25661920 2015 CCAR2 negatively regulates nuclear receptor LXR? by competing with SIRT1 deacetylase.
25659329 2015 LXR agonist T0901317-Induced hyperlipidemia does not lead to lipid accumulation in the rat heart.
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPAR?/LXR? signaling pathway in THP-1 macrophage-derived foam cells.
25437875 2015 Hepatic TRAP80 selectively regulates lipogenic activity of liver X receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25332231 2015 LIM-only protein FHL2 is a positive regulator of liver X receptors in smooth muscle cells involved in lipid homeostasis.
25283515 2014 Modulation of LXR-? and the effector genes by Ascorbic acid and Statins in psoriatic keratinocytes.
25264165 2014 Binding of polyunsaturated fatty acids to LXR? and modulation of SREBP-1 interaction with a specific SCD1 promoter element.
25255963 2014 The influence of ligand-activated LXR on primary human trophoblasts.
25187371 2015 PRMT3 regulates hepatic lipogenesis through direct interaction with LXR?.
25102981 2014 Expression of liver X receptor correlates with intrahepatic inflammation and fibrosis in patients with nonalcoholic fatty liver disease.
25073010 2014 Liver X receptor ? (LXR?/NR1H3) regulates differentiation of hepatocyte-like cells via reciprocal regulation of HNF4?.
25035925 2014 Interleukin-10 increases reverse cholesterol transport in macrophages through its bidirectional interaction with liver X receptor ?.
25028566 2014 Transcriptional regulation of human hydroxysteroid sulfotransferase SULT2A1 by LXR?.
25005769 2014 Association between single nucleotide polymorphisms of sterol regulatory element binding protein-2 and liver X receptor ? gene and risk of polycystic ovary syndrome in a Chinese Han population.
24996838 2014 Cholesterol efflux is LXR? isoform-dependent in human macrophages.
24886807 2014 Liver X receptors alpha gene (NR1H3) promoter polymorphisms are associated with systemic lupus erythematosus in Koreans.
24842676 2014 Levels of liver X receptors in testicular biopsies of patients with azoospermia.
24832115 2014 The medicinal chemistry of liver X receptor (LXR) modulators.
24751522 2014 miR-613 regulates cholesterol efflux by targeting LXR? and ABCA1 in PPAR? activated THP-1 macrophages.
24713062 2014 Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor ? with liver X receptor ?.
24618263 2015 Activation of liver X receptors inhibits experimental fibrosis by interfering with interleukin-6 release from macrophages.
24533572 2014 Association of liver X receptor ? (LXR?) gene polymorphism and coronary heart disease, serum lipids and glucose levels.
24289152 2014 Platelet-activating factor downregulates the expression of liver X receptor-? and its target genes in human neutrophils.
24278306 2013 Effects of NR1H3 genetic variation on the expression of liver X receptor ? and the progression of Alzheimer's disease.
24265317 2014 Ursodeoxycholic acid inhibits liver X receptor ?-mediated hepatic lipogenesis via induction of the nuclear corepressor SMILE.
24180251 Association of LXR? polymorphisms with obesity and obesity-related phenotypes in an Iranian population.
24118845 2013 The role of the liver X receptor in chronic obstructive pulmonary disease.
24100084 2013 Lack of association between LXR? and LXR? gene polymorphisms and prevalence of metabolic syndrome: a case-control study of an Iranian population.
24036496 2013 Liver X receptor activation stimulates iron export in human alternative macrophages.
23867395 2013 Liver X receptor ? inhibits osteosarcoma cell proliferation through up-regulation of FoxO1.
23838803 2013 Association of liver X receptors (LXRs) genetic variants to gallbladder cancer susceptibility.
23812424 2014 LXR?-mediated downregulation of FOXM1 suppresses the proliferation of hepatocellular carcinoma cells.
23733886 2013 The LXR-IDOL axis defines a clathrin-, caveolae-, and dynamin-independent endocytic route for LDLR internalization and lysosomal degradation.
23732298 2013 Dual roles of nuclear receptor liver X receptor ? (LXR?) in the CYP3A4 expression in human hepatocytes as a positive and negative regulator.
23686114 2013 Differential regulation of gene expression by LXRs in response to macrophage cholesterol loading.
23680128 2013 Oxidized eicosapentaenoic acids more potently reduce LXR?-induced cellular triacylglycerol via suppression of SREBP-1c, PGC-1? and GPA than its intact form.
23564066 2013 Neopterin negatively regulates expression of ABCA1 and ABCG1 by the LXR? signaling pathway in THP-1 macrophage-derived foam cells.
23496987 2013 MicroRNA-613 represses lipogenesis in HepG2 cells by downregulating LXR?.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23451202 2013 Foam cell specific LXR? ligand.
23416078 2013 Thyroid hormone receptor and liver X receptor competitively up-regulate human selective Alzheimer's disease indicator-1 gene expression at the transcriptional levels.
23393188 2013 Genome-wide analysis of LXR? activation reveals new transcriptional networks in human atherosclerotic foam cells.
23313547 2013 Knock-down of the oxysterol receptor LXR? impairs cholesterol efflux in human primary macrophages: lack of compensation by LXR? activation.
23185273 2012 Identification of biological markers of liver X receptor (LXR) activation at the cell surface of human monocytes.
23163651 2012 Altered levels of LXR-?: crucial implications in the pathogenesis of vitiligo.
23099324 2013 Activation of the liver X receptor-? potently inhibits osteoclastogenesis from lipopolysaccharide-exposed bone marrow-derived macrophages.
23041609 2012 Liver X receptor ? bidirectionally transactivates human CYP1A1 and CYP1A2 through two cis-elements common to both genes.
23018104 2012 Activation of liver X receptor attenuates endothelin-1 expression in vascular endothelial cells.
22990668 2013 Activation of liver X receptors suppresses inflammatory gene expressions and transcriptional corepressor clearance in rheumatoid arthritis fibroblast like synoviocytes.
22984430 2012 Sirtuin 1 regulates SREBP-1c expression in a LXR-dependent manner in skeletal muscle.
22916038 2012 Use of allele-specific FAIRE to determine functional regulatory polymorphism using large-scale genotyping arrays.
22766509 2012 Lipid metabolism and neuroinflammation in Alzheimer's disease: a role for liver X receptors.
22749359 2012 Cyanidin-3-O-?-glucoside induces oxysterol efflux from endothelial cells: role of liver X receptor alpha.
22723445 2012 Liver X receptor activation reduces angiogenesis by impairing lipid raft localization and signaling of vascular endothelial growth factor receptor-2.
22707265 2012 Taurine is a liver X receptor-? ligand and activates transcription of key genes in the reverse cholesterol transport without inducing hepatic lipogenesis.
22641099 2012 Liver X receptor ?-mediated regulation of lipogenesis by core and NS5A proteins contributes to HCV-induced liver steatosis and HCV replication.
22634718 2012 Liver X receptor regulates rheumatoid arthritis fibroblast-like synoviocyte invasiveness, matrix metalloproteinase 2 activation, interleukin-6 and CXCL10.
22610535 2013 The oxysterol receptors LXR? and LXR? suppress proliferation in the colon.
22569763 2012 Increased serum liver X receptor ligand oxysterols in patients with non-alcoholic fatty liver disease.
22547570 2012 Lxr? regulates the androgen response in prostate epithelium.
22503545 2012 PAPP-A negatively regulates ABCA1, ABCG1 and SR-B1 expression by inhibiting LXR? through the IGF-I-mediated signaling pathway.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
22399489 2012 Differential expression and function of alternative splicing variants of human liver X receptor ?.
22367754 2012 Phospholipase A(2)-modified low-density lipoprotein activates liver X receptor in human macrophages.
22311022 2012 Genetic variations in SREBP-1 and LXR? are not directly associated to PCOS but contribute to the physiological specifics of the syndrome.
22257474 2012 Liver X receptors bridge hepatic lipid metabolism and inflammation.
22137263 2012 Lycopene and the LXR? agonist T0901317 synergistically inhibit the proliferation of androgen-independent prostate cancer cells via the PPAR?-LXR?-ABCA1 pathway.
22027013 2012 Genetic analysis of genes involved in amyloid-? degradation and clearance in Alzheimer's disease.
21951066 2011 The oxysterol 27-hydroxycholesterol regulates ?-synuclein and tyrosine hydroxylase expression levels in human neuroblastoma cells through modulation of liver X receptors and estrogen receptors--relevance to Parkinson's disease.
21937108 2011 RXR? and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21903943 2011 Genetic variation in liver X receptor alpha and risk of ischemic vascular disease in the general population.
21889884 2012 Liver X receptor negatively regulates fibroblast growth factor 21 in the fatty liver induced by cholesterol-enriched diet.
21775116 2012 Trans-10, cis-12 conjugated linoleic acid decreases de novo lipid synthesis in human adipocytes.
21625070 2011 Decreased expression of liver X receptor-? in macrophages infected with Chlamydia pneumoniae in human atherosclerotic arteries in situ.
21562465 2011 Liver X receptor ? gene polymorphisms and variable cardiovascular outcomes in patients treated with antihypertensive therapy: results from the INVEST-GENES study.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21440016 2011 Oxygenated derivatives of cholesterol promote hepatitis B virus gene expression through nuclear receptor LXR? activation.
21356276 2011 Liver X receptor-?/? expression ratio is increased in ACTH-secreting pituitary adenomas.
21350215 2011 Human atherosclerotic plaque alternative macrophages display low cholesterol handling but high phagocytosis because of distinct activities of the PPAR? and LXR? pathways.
21349840 2011 Liver X receptor-retinoid X receptor (LXR-RXR) heterodimer cistrome reveals coordination of LXR and AP1 signaling in keratinocytes.
21316679 2011 Associations between common genetic polymorphisms in the liver X receptor alpha and its target genes with the serum HDL-cholesterol concentration in adolescents of the HELENA Study.
21315073 2011 CIDEA interacts with liver X receptors in white fat cells.
21310851 2011 MicroRNA hsa-miR-613 targets the human LXR? gene and mediates a feedback loop of LXR? autoregulation.
21268089 2011 Molecular mechanisms underlying the inhibition of IFN-?-induced, STAT1-mediated gene transcription in human macrophages by simvastatin and agonists of PPARs and LXRs.
21266776 2011 Liver X receptor (LXR) mediates negative regulation of mouse and human Th17 differentiation.
21245992 2011 Polymorphisms in NF-?B, PXR, LXR, PPAR? and risk of inflammatory bowel disease.
21187453 2011 Constitutive activation of LXR in macrophages regulates metabolic and inflammatory gene expression: identification of ARL7 as a direct target.
21136146 2011 Elevated expression of liver X receptor alpha (LXR?) in myocardium of streptozotocin-induced diabetic rats.
21125317 2011 LXR-? selectively reprogrammes cancer cells to enter into apoptosis.
21042792 2011 Genetic variation within the NR1H2 gene encoding liver X receptor ? associates with insulin secretion in subjects at increased risk for type 2 diabetes.
20945144 2010 Activation of LXR? induces lipogenesis in HaCaT cells.
20868688 2010 FoxO1 represses LXR?-mediated transcriptional activity of SREBP-1c promoter in HepG2 cells.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20837115 2011 Regulation of LPCAT3 by LXR.
20836841 2010 Polymorphisms in NFkB, PXR, LXR and risk of colorectal cancer in a prospective study of Danes.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20682316 2010 Molecular determinants of the interactions between SRC-1 and LXR/RXR heterodimers.
20655109 2010 Expression of liver X receptors in pregnancies complicated by preeclampsia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20506155 2010 Anti-atherogenic effect of berberine on LXRalpha-ABCA1-dependent cholesterol efflux in macrophages.
20494359 2010 LXRalpha regulates human CETP expression in vitro and in transgenic mice.
20410489 2010 Activation of liver X receptor sensitizes human dendritic cells to inflammatory stimuli.
20364260 2010 LXR activation inhibits chemokine-induced CD4-positive lymphocyte migration.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219900 2010 Activation of LXR increases acyl-CoA synthetase activity through direct regulation of ACSL3 in human placental trophoblast cells.
20190811 2010 Liver X Receptor activation downregulates AKT survival signaling in lipid rafts and induces apoptosis of prostate cancer cells.
20139031 2010 Tryptase promotes human monocyte-derived macrophage foam cell formation by suppressing LXRalpha activation.
20118482 2010 Mesenchymal stem cells differentiate into renin-producing juxtaglomerular (JG)-like cells under the control of liver X receptor-alpha.
20080977 2010 Orphan nuclear receptor DAX-1 acts as a novel corepressor of liver X receptor alpha and inhibits hepatic lipogenesis.
20057170 2010 TGF-beta1 up-regulates expression of ABCA1, ABCG1 and SR-BI through liver X receptor alpha signaling pathway in THP-1 macrophage-derived foam cells.
20037595 2010 Tumor-mediated liver X receptor-alpha activation inhibits CC chemokine receptor-7 expression on dendritic cells and dampens antitumor responses.
20005944 2010 Inhibition of SREBP-1c-mediated hepatic steatosis and oxidative stress by sauchinone, an AMPK-activating lignan in Saururus chinensis.
19933273 2010 Nuclear receptor liver X receptor is O-GlcNAc-modified in response to glucose.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837721 2010 Liver X receptor in cholesterol metabolism.
19798078 2010 Psoriasis: crucial role of LXR-alpha RNomics.
19796621 2009 Liver X receptors and oxysterols promote ventral midbrain neurogenesis in vivo and in human embryonic stem cells.
19697157 2009 Liver X receptor ?: maintenance of epidermal expression in intrinsic and extrinsic skin aging.
19645823 2010 Liver X receptor expression in human melanocytes, does it have a role in the pathogenesis of vitiligo?
19628791 2009 Induction of transglutaminase 2 by a liver X receptor/retinoic acid receptor alpha pathway increases the clearance of apoptotic cells by human macrophages.
19481530 2009 GPS2 is required for cholesterol efflux by triggering histone demethylation, LXR recruitment, and coregulator assembly at the ABCG1 locus.
19436111 2009 Liver X receptors contribute to the protective immune response against Mycobacterium tuberculosis in mice.
19426978 2009 LXR-activating oxysterols induce the expression of inflammatory markers in endothelial cells through LXR-independent mechanisms.
19380774 2009 Liver X receptors control IgE expression in B cells.
19366697 2009 Interrelationship between liver X receptor alpha, sterol regulatory element-binding protein-1c, peroxisome proliferator-activated receptor gamma, and small heterodimer partner in the transcriptional regulation of glucokinase gene expression in liver.
19360318 2009 Impact of cholesterol metabolism and the LXRalpha-SREBP-1c pathway on nonalcoholic fatty liver disease.
19292929 2009 Functional and genetic analysis in type 2 diabetes of liver X receptor alleles--a cohort study.
19261092 2009 Expression of liver X receptor alpha and lipid metabolism in granulocyte-macrophage colony-stimulating factor-induced human monocyte-derived macrophage.
19229075 2009 FGF-1 induces expression of LXRalpha and production of 25-hydroxycholesterol to upregulate the apoE gene in rat astrocytes.
19211025 2009 Functional genomics of blood cellular LXR-alpha gene in human coronary heart disease.
19201410 2009 On the mechanism for PPAR agonists to enhance ABCA1 gene expression.
19164445 2009 Liver X receptor ligands suppress ubiquitination and degradation of LXRalpha by displacing BARD1/BRCA1.
19119143 2009 Suppression of 2,3-oxidosqualene cyclase by high fat diet contributes to liver X receptor-alpha-mediated improvement of hepatic lipid profile.
19105208 2009 Liver X receptor mediates hepatitis B virus X protein-induced lipogenesis in hepatitis B virus-associated hepatocellular carcinoma.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
18854425 2008 25-Hydroxycholesterol-3-sulfate regulates macrophage lipid metabolism via the LXR/SREBP-1 signaling pathway.
18789440 2009 IFN-gamma down-regulates ABCA1 expression by inhibiting LXRalpha in a JAK/STAT signaling pathway-dependent manner.
18669643 2008 Selective partial agonism of liver X receptor alpha is related to differential corepressor recruitment.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18562803 2008 FXRalpha down-regulates LXRalpha signaling at the CETP promoter via a common element.
18511497 2008 The nuclear receptor Rev-erbalpha is a liver X receptor (LXR) target gene driving a negative feedback loop on select LXR-induced pathways in human macrophages.
18372238 2008 Protein kinase C alpha modulates liver X receptor alpha transactivation.
18327405 2008 C-reactive protein induces pro- and anti-inflammatory effects, including activation of the liver X receptor alpha, on human monocytes.
18276933 2008 Endoglin (CD105) expression is regulated by the liver X receptor alpha (NR1H3) in human trophoblast cell line JAR.
18250151 2008 Phosphorylation of liver X receptor alpha selectively regulates target gene expression in macrophages.
18209740 2008 Association between liver X receptor alpha gene polymorphisms and risk of metabolic syndrome in French populations.
18182682 2008 Thematic review series: skin lipids. Peroxisome proliferator-activated receptors and liver X receptors in epidermal biology.
18096827 2008 Laminar shear stress regulates liver X receptor in vascular endothelial cells.
18024509 2008 Regulation of human 3 alpha-hydroxysteroid dehydrogenase (AKR1C4) expression by the liver X receptor alpha.
18007013 2008 Increased expression of LXR alpha, ABCG5, ABCG8, and SR-BI in the liver from normolipidemic, nonobese Chinese gallstone patients.
17960176 2008 LXRalpha enhances lipid synthesis in SZ95 sebocytes.
17845217 2007 Characterization of liver X receptor expression and function in human skin and the pilosebaceous unit.
17766241 2007 Novel role for the liver X nuclear receptor in the suppression of lung inflammatory responses.
17724434 2008 Liver X receptor is a key regulator of cytokine release in human monocytes.
17693624 2007 Liver X receptors inhibit human monocyte-derived macrophage foam cell formation by inhibiting fluid-phase pinocytosis of LDL.
17644777 2007 Atorvastatin decreases lipoprotein lipase and endothelial lipase expression in human THP-1 macrophages.
17628006 2007 Liver X receptor-alpha gene expression is positively regulated by thyroid hormone.
17452725 2007 Liver X receptor alpha associates with human life span.
17416342 2007 The liver X receptor agonist T0901317 acts as androgen receptor antagonist in human prostate cancer cells.
17405904 2007 Liver X receptor stimulates cholesterol efflux and inhibits expression of proinflammatory mediators in human airway smooth muscle cells.
17396233 2007 Adipocyte fatty acid-binding protein (aP2), a newly identified LXR target gene, is induced by LXR agonists in human THP-1 cells.
17391100 2007 Molecular basis for repression of liver X receptor-mediated gene transcription by receptor-interacting protein 140.
17296605 2007 Protein kinase A suppresses sterol regulatory element-binding protein-1C expression via phosphorylation of liver X receptor in the liver.
17272748 2007 High frequency of a retinoid X receptor gamma gene variant in familial combined hyperlipidemia that associates with atherogenic dyslipidemia.
17255360 2007 Liver X receptors regulate dendritic cell phenotype and function through blocked induction of the actin-bundling protein fascin.
17218271 2007 Parallel SUMOylation-dependent pathways mediate gene- and signal-specific transrepression by LXRs and PPARgamma.
17217555 2007 The lipoprotein/lipid profile is modulated by a gene-diet interaction effect between polymorphisms in the liver X receptor-alpha and dietary cholesterol intake in French-Canadians.
17186944 2007 Selective up-regulation of LXR-regulated genes ABCA1, ABCG1, and APOE in macrophages through increased endogenous synthesis of 24(S),25-epoxycholesterol.
17135302 2007 ROS and NF-kappaB but not LXR mediate IL-1beta signaling for the downregulation of ATP-binding cassette transporter A1.
17110595 2006 A nuclear receptor corepressor-dependent pathway mediates suppression of cytokine-induced C-reactive protein gene expression by liver X receptor.
17108812 2006 Liver X receptor gene polymorphisms and adipose tissue expression levels in obesity.
16973760 2007 Liver X receptors regulate adrenal steroidogenesis and hypothalamic-pituitary-adrenal feedback.
16956579 2006 The human myeloperoxidase gene is regulated by LXR and PPARalpha ligands.
16941683 2006 Investigation of the Lith1 candidate genes ABCB11 and LXRA in human gallstone disease.
16920108 2006 Identification of human low-density lipoprotein receptor as a novel target gene regulated by liver X receptor alpha.
16904112 2006 Phosphorylation of the liver X receptors.
16758300 2006 Importance of LXR-alpha transcriptome in the modulation of innate immunity.
16567856 2006 Assessing the effects of LXR agonists on cellular cholesterol handling: a stable isotope tracer study.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16482468 2006 Activation of liver X receptors promotes lipid accumulation but does not alter insulin action in human skeletal muscle cells.
16354658 2006 A novel principle for partial agonism of liver X receptor ligands. Competitive recruitment of activators and repressors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16249184 2005 Liver X receptor alpha interferes with SREBP1c-mediated Abcd2 expression. Novel cross-talk in gene regulation.
16170053 2005 Identification and characterization of two alternatively spliced transcript variants of human liver X receptor alpha.
16141411 2005 Liver X receptor activation controls intracellular cholesterol trafficking and esterification in human macrophages.
16106051 2005 Downregulation of liver X receptor-alpha in mouse kidney and HK-2 proximal tubular cells by LPS and cytokines.
16054077 2005 Diet-dependent cardiovascular lipid metabolism controlled by hepatic LXRalpha.
15625283 2005 Expression of the LXRalpha protein in human atherosclerotic lesions.
15548517 2005 Adipocytic differentiation and liver x receptor pathways regulate the accumulation of triacylglycerols in human vascular smooth muscle cells.
15539633 2004 Liver X receptor agonists suppress vascular smooth muscle cell proliferation and inhibit neointima formation in balloon-injured rat carotid arteries.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353176 2004 Nuclear receptor LXRalpha is involved in cAMP-mediated human renin gene expression.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15319359 2004 Unliganded thyroid hormone receptor-beta1 represses liver X receptor alpha/oxysterol-dependent transactivation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699103 2004 Transcription of the vascular endothelial growth factor gene in macrophages is regulated by liver X receptors.
12957674 2003 Transcriptional regulation of farnesyl pyrophosphate synthase by liver X receptors.
12932788 2003 Molecular determinants of LXRalpha agonism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470296 2003 Potentiation of liver X receptor transcriptional activity by peroxisome-proliferator-activated receptor gamma co-activator 1 alpha.
12198243 2002 The small heterodimer partner interacts with the liver X receptor alpha and represses its transcriptional activity.
12161442 2002 Fatty acid regulation of liver X receptors (LXR) and peroxisome proliferator-activated receptor alpha (PPARalpha ) in HEK293 cells.
12117567 2002 The atypical interaction of peroxisome proliferator-activated receptor alpha with liver X receptor alpha antagonizes the stimulatory effect of their respective ligands on the murine cholesterol 7alpha-hydroxylase gene promoter.
12054659 2002 Different regulation of the LXRalpha promoter activity by isoforms of CCAAT/enhancer-binding proteins.
12040021 2002 Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism.
12032151 2002 Regulated expression of the apolipoprotein E/C-I/C-IV/C-II gene cluster in murine and human macrophages. A critical role for nuclear liver X receptors alpha and beta.
11149950 2001 LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes.
11135616 2001 PPAR-alpha and PPAR-gamma activators induce cholesterol removal from human macrophage foam cells through stimulation of the ABCA1 pathway.
11090131 2000 Role of LXRs in control of lipogenesis.
11035776 2000 Control of cellular cholesterol efflux by the nuclear oxysterol receptor LXR alpha.
10022764 1998 Receptor-interacting protein 140 interacts with and inhibits transactivation by, peroxisome proliferator-activated receptor alpha and liver-X-receptor alpha.
9630215 1998 Cholesterol and bile acid metabolism are impaired in mice lacking the nuclear oxysterol receptor LXR alpha.
9231657 1997 Tissue distribution and quantification of the expression of mRNAs of peroxisome proliferator-activated receptors and liver X receptor-alpha in humans: no alteration in adipose tissue of obese and NIDDM patients.
9013544 1997 Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway.
8621574 1996 The orphan nuclear hormone receptor LXR alpha interacts with the peroxisome proliferator-activated receptor and inhibits peroxisome proliferator signaling.
8510758 1993 Fusion of CHOP to a novel RNA-binding protein in human myxoid liposarcoma.
7744246 1995 LXR, a nuclear receptor that defines a distinct retinoid response pathway.