Property Summary

Ligand Count 255
NCBI Gene PubMed Count 258
PubMed Score 123.05
PubTator Score 299.79

Knowledge Summary

Patent (6,521)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.493 3.1e-03
active ulcerative colitis -1.109 7.0e-03
adrenocortical carcinoma -1.250 3.1e-03
ductal carcinoma in situ -1.100 1.7e-02
head and neck cancer and chronic obstruc... 1.100 2.1e-04
invasive ductal carcinoma -1.200 1.1e-02
malignant mesothelioma 1.400 3.5e-06
osteosarcoma -1.876 8.9e-03
psoriasis -1.300 1.0e-07
tuberculosis 1.100 9.7e-04

Protein-protein Interaction (7)

Gene RIF (230)

AA Sequence

MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRA      1 - 70
EPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHC     71 - 140
PMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ    141 - 210
LGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ    211 - 280
LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ    281 - 350
LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV    351 - 420
HSEQVFALRLQDKKLPPLLSEIWDVHE                                               421 - 447
//

Text Mined References (259)

PMID Year Title