Property Summary

NCBI Gene PubMed Count 119
PubMed Score 40.62
PubTator Score 125.47

Knowledge Summary

Patent (7,498)

TINX Plot

  Disease (2)

Disease Target Count
Cholestasis 93
Liver carcinoma 217
Disease Target Count P-value
psoriasis 6685 2.2e-04
diabetes mellitus 1663 1.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.400 2.2e-04
diabetes mellitus -1.500 1.4e-03

Synonym

Accession P55055 A8K490 B4DNM6 E7EWA6 Q12970 Q5I0Y1
Symbols NER
UNR
LXRB
LXR-b
NER-I
RIP15

Gene

PDB

5HJP   5I4V   5KYA   5KYJ   3L0E   4NQA   1P8D   1PQ6   1PQ9   1PQC   1UPV   1UPW   3KFC   4DK7   4DK8   4RAK  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (2)

Steve Finkbeiner 41 Neuron specific phenotypes being screened
Jun Qin 39 Signaling network evaluation of transcript factor crosstalk via catTRE/MS

Protein-protein Interaction (1)

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
2117 screening 7 / 0 / 0 Late stage results from the probe development effort to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR).
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
463143 screening 0 / 0 / 6 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based cell-based assay to identify activators of the liver X receptor (LXR)
463150 confirmatory 0 / 0 / 1 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based dose response assay to identify activators of the liver X receptor (LXR)
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624279 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16
720737 confirmatory 0 / 0 / 240 Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based screening assay to identify agonists of the Liver-X-Receptor (LXR).
743027 screening 1 / 0 / 3415 Counterscreen for agonists of the DAF-12 from the parasite H.contortus (hcDAF-12): Luminescence-based cell-based screening assay to identify agonists of the Liver-X-Receptor (LXR).
743037 confirmatory 0 / 0 / 247 Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based dose response assay to identify agonists of the Liver-X-Receptor (LXR).
743051 screening 0 / 0 / 3347 Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based screening assay to identify agonists of the Liver-X-Receptor (LXR)
More...

Gene RIF (98)

PMID Text
26814197 these data identify a new mechanism of LXR regulation that involves TIPARP, ADP-ribosylation and MACROD1.
26602218 Intestinal activation of LXR reduces the production of chylomicrons by a mechanism dependent on the apical localization of SR-B1.
26450852 predominant cytoplasmic localization of LXRbeta, which occurs in colon cancer cells but not in normal colon epithelial cells, allowed LXR ligand-induced pyroptosis
26434697 Destabilization of the torsioned conformation of a ligand side chain inverts the LXRbeta activity.
26263968 the release of NER components such as DNA damage binding protein 2 (DDB2) and Xeroderma Pigmentosum complementation group C protein (XPC) following oxidative stress might putatively involve their apoptotic role rather than DNA repair function.
26019035 LXRalpha expression was not altered in NAFLD.
26009170 Recent high-throughput analyses of RNA-protein interactions indicate that Unr binds to a large subset of cellular mRNAs, suggesting that Unr may play a wider role in translational responses to cellular signals than previously thought.
25980575 This study provides the first evidence to show LXR activation reduces cadmium-induced apoptotic cell death of human renal proximal tubular cells by inhibition of reactive oxygen species production and JNK activation.
25659329 LXRb is the dominant isoform in the rat myocardium and the expression of both LXR isoforms (LXRa and LXRb) did not change after administration of T0901317
25124554 LXR-b, through pannexin 1 interaction, can specifically induce caspase-1-dependent colon cancer cell death by pyroptosis.
24863943 Data show that phospholipase C epsilon 1 (PLCE1) and liver X receptor-beta (LXR-beta) network interactions as important contributory factors for genetic predisposition in gallbladder cancer.
24842676 Report significant reduction in LXR-beta transcript in testes of men with azoospermia.
24832115 Studies indicate that no liver X receptor (LXR) modulator has successfully progressed beyond phase I clinical trials.
24618263 Activation of LXRs interfered with the release of interleukin-6 from macrophages and, thus, inhibited fibroblast activation and collagen release.
24561505 structural analysis of human retinoid X receptor alpha-liver X receptor beta (RXRalpha-LXRbeta) heterodimer on its cognate element, an AGGTCA direct repeat spaced by 4 nt
24398515 LXR-beta has roles in regulation of endothelial cellular senescence, related to its antiatherogenic properties
24100084 Variants in LXRalpha and LXRbeta genes are not potential contributors to the risk of metabolic syndrome and related traits in an Iranian population.
23987069 Molecular modeling of interaction of 17(20)Z- and 17(20)E-pregna-5,17(20)-dien-21-oyl amides with the nuclear receptor LXRbeta
23867501 LXRbeta has nonnuclear function in endothelial cell caveolae/lipid rafts that entails crosstalk with estrogen receptor alpha.
23838803 Data indicate that LXR-beta genotypes (rs35463555) and (rs2695121) were associated with risk of gallbladder cancer (GBC) as compared to healthy controls whereas LXR-alpha (rs7120118) was not associated with GBC risk.
23686114 Treatment of human THP-1 macrophages with endogenous or synthetic LXR ligands stimulates both transcriptional and posttranscriptional pathways that result in the selective recruitment of the LXRalpha subtype to LXR-regulated promoters.
23223141 In human primary melanocytes, MNT-1, and B16 melanoma cells, TO901317, a synthetic LXR ligand, inhibited melanogenesis.
23018104 Activation of LXR reduced the binding of the transcriptional factors AP-1 and NF-kappaB to the ET-1 gene promoter region, thereby regulating gene expression.
22990668 Both LXRalpha and LXRbeta are expressed in rheumatoid arthritis fibroblast-like synoviocytes during inflammatory responses. FLS
22766509 Discussion of the role of LXR in orchestrating lipid homeostasis and neuroinflammation in the brain. The ability of LXR to attenuate Alzheimer disease pathology makes them potential therapeutic targets for this neurodegenerative disease. [Review Article]
22723445 Pharmacological activation of endothelial LXRs reduces angiogenesis by restraining cholesterol-dependent vascular endothelial growth factor receptor-2 compartmentation and signaling.
22610535 Activation of LXR-alpha and LXR-beta Suppresses Proliferation of Human Colon Cancer Cells.
22367754 liver x receptors are activated by phospholipase A2 modified low density lipoproteins in human macrophages
22257474 LXR are involved in the metabolism and inflammation in human diseases; nonalcoholic fatty liver disease (NAFLD) is classically associated with lipid metabolic disorders and inflammatory responses.
22029530 There was no association between NR1H3 SNPs and pre-eclampsia, but the NR1H2 polymorphism rs2695121 was strongly associated with preeclampsia.
22027013 Te results of this study suggested taht genetic variations in MMEL1, ECE1, ECE2, AGER, PLG, PLAT, NR1H3, MMP3, LRP1, TTR, NR1H2, and MMP9 genes do not play major role among the Finnish AD patient cohort.
21951066 Concomitant activation of ERbeta and inhibition of LXRbeta prevents 27-hydroxycholesterol effects and reduces the progression of Parkinson's disease by precluding tyrosine hydroxylase reduction and alpha-synuclein accumulation.
21937108 RXRalpha and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21507939 LXRbeta can cause a post-translational response by binding directly to ABCA1, as well as a transcriptional response, to maintain cholesterol homeostasis.
21356276 we concluded that LXR-alpha/beta gene expression ratio is a critical factor to activate POMC gene expression in ACTH-secreting pituitary adenomas.
21315073 CIDEA binds to liver X receptors and regulates their activity in vitro.
21042792 In subjects of European ancestry at increased risk for type 2 diabetes, common variation within the NR1H2 gene impaired insulin secretion, which may facilitate the development of type 2 diabetes.
21042792 Observational study of gene-disease association. (HuGE Navigator)
20939869 The C allele of rs28514894 was associated with ~1.25-fold higher human LXRb basal promoter activity in vitro.
20939869 Observational study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20836841 Polymorphism in LXR was not associated with colorectal cancer.
20655109 placental protein level of LXRbeta was reduced, and there was a positive correlation between placental LXRbeta mRNA expression and placental free fatty acids in preeclampsia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20364260 LXR activation inhibits chemokine-induced migration of CD4-positive lymphocytes by reducing PI-3 kinase activity and activation of Rac-1 with subsequent inhibition of MLC phosphorylation, f-actin formation and ICAM3 translocation.
20219900 Results suggest that liver X receptors play a regulatory role in fatty acid metabolism by direct regulation of ACSL3 in human placental trophoblast cells.
20176747 hDIO2 promoter is down-regulated at the transcriptional level by both LXR and RXR signal pathway.
20159957 selective synthetic agonists induce SUMOylation-dependent recruitment of either LRH-1 or LXR to hepatic APR promoters and prevent the clearance of the N-CoR corepressor complex upon cytokine stimulation
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19933273 O-GlcNAcylation of LXR is a novel mechanism by which LXR acts as a glucose sensor affecting LXR-dependent gene expression, substantiating the crucial role of LXR as a nutritional sensor in lipid and glucose metabolism.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837721 LXRalpha and LXRbeta control cholesterol homeostasis.
19796621 Deletion of liver X receptors (Lxralpha and beta) reduced cell cycle progression and ventral midbrain neurogenesis, resulting in decreased dopaminergic neurons at birth.
19481530 Data describe the requirement of GPS2 for ABCG1 gene transcription and cholesterol efflux from macrophages, and implicate GPS2 in facilitating LXRalpha/beta recruitment to an ABCG1-specific promoter/enhancer unit upon ligand activation.
19426978 LXR-activating oxysterols induce the expression of inflammatory markers in endothelial cells through LXR-independent mechanisms.
19303409 modulation of cholesterol metabolism via intraluminal phospholipids is related to the activity of the oxysterol nuclear receptor LXR
19292929 Variations in the LXRB gene promoter may be part of the aetiology of type 2 diabetes
19292929 Observational study of gene-disease association. (HuGE Navigator)
19242521 SREBP-1c expression increases during keratinocyte differentiation, and LXR activation enhances its expression
19105208 mediates HBV-associated hepatic steatosis
18854425 25-Hydroxycholesterol-3-sulfate regulates macrophage lipid metabolism via the LXR/SREBP-1 signaling pathway.
18782758 nuclear liver X receptor-beta interaction with ABCA1 modulates cholesterol efflux
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18597895 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18221307 Analysis of the protein-ligand complexes of X-ray crystallography-derived structures revealed that residues His435 and Trp457 act as a switch that mediates ligand activation
18182682 review of role of activation of PPARalpha, -beta/delta, or -gamma or LXRs in skin physiology and cytology and disease
18081155 The current study of a Spanish population does not demonstrate an association between LXRbeta genotypes or haplotypes and Alzheimer's disease.
18081155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18026184 none of the SNPs typed for NAT2, ERCC1, ERCC4 and ERCC6 showed significant association with risk
17900622 Subjects carrying both the CD14 (-260) C/C and the LXRbeta (intron 5) G/G genotypes had a six times lower risk of developing AD than subjects without these risk genotypes. These data support a role for innate immune response genes in risk for AD.
17900622 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17845217 LXRalpha and LXRbeta are expresed in the majority of the cell types in human skin. .
17766241 In summary, this study is the first to demonstrate anti-inflammatory actions of LXRs in the lung.
17724434 It was proposed that LXR is a key regulator of cytokine release in LPS-challenged human monocytes, possibly by interfering with translational events.
17626048 Glucose significantly induces transcription via the LXRB gene promoter and that the identified binding sites are important for proper glucose responsiveness.
17405904 We show here that primary hASM cells express liver X receptor (LXR; alpha and beta subtypes), an oxysterol-activated nuclear receptor that controls expression of genes involved in lipid and cholesterol homeostasis, and inflammation.
17396233 These data indicate for the first time that human macrophage aP2 promoter is a direct target for the regulation by LXR/RXR heterodimers.
17391100 Results suggest that co-repression of LXR activity by RIP140 involves an atypical binding mode of RIP140 and a repression element in the RIP140 C-terminus.
17218271 These studies define parallel but functionally distinct pathways that are utilized by PPARgamma and LXRs to differentially regulate complex programs of gene expression that control immunity and homeostasis.
17135302 ROS and NF-kappaB, but not LXR, mediate the IL-1beta-induced downregulation of ABCA1 via a novel transcriptional mechanism, which might play an important role of proinflammation in the alteration of lipid metabolism.
17110595 novel mechanism of inflammatory gene regulation(C-reactive protein) by LXR ligands
17108812 One LXRA single nucleotide polymorphism, rs2279238, and one common haplotype, CAAGCC, as well as two LXRB single nucleotide polymorphisms, LB44732G>A and rs2695121, were associated with obesity phenotypes.
17045963 This suggests ABCC6 gene expression and the first identification of a transcription factor which is relevant to regulation of ABCC6 level in tissues and in some PXE patients.
16973760 LXR-alpha and LXR-beta independently interfere with the hypothalamic-pituitary-adrenal axis regulation at the level of the pituitary and the adrenal gland
16904112 Results provide evidence that liver X receptors alpha and beta are phosphorylated proteins.
16567856 Data demonstrate that LXR-beta activation altered all of the cellular cholesterol fluxes.
16524875 24(S)-hydroxycholesterol induces apoE-mediated efflux of cholesterol in astrocytes via an LXR-controlled pathway
16482468 LXR agonists may lead to increased utilisation of lipids and glucose in muscle cells without affecting the mechanism of action of insulin.
16354658 competitive binding of coactivators and corepressors can explain the tissue-specific behavior of partial liver X receptor alpha and beta agonists
16298468 These results show that LXR stimulated preferentially triglyceride accumulation in human preadipocytes via the induction of de novo lipogenesis, rather than activating the differentiation process through PPARgamma activation.
15548517 activation of the liver X receptors (LXR) dramatically promoted lipid accumulation in vascular smooth muscle cells
15539633 LXRs are expressed and functional in primary human coronary artery smooth muscle cells; their ligands inhibit cell proliferation and neointima formation
14699103 LXRalpha and LXRbeta regulate transcription of the vascular endothelial growth factor gene in macrophages
14643652 X-ray crystal structure of the liver X receptor beta ligand-binding domain in complex with a synthetic agonist, T-0901317
12957674 hLXRalpha and hLXRgeta transactivated a reporter gene bearing a truncated FPPS promoter containing a putative direct repeat 4 (DR4) LXR response element, and direct interaction was demonstrated
12736258 X-ray crystal structure of the liver X receptor beta ligand binding domain: regulation by a histidine-tryptophan switch.
12393874 regulated AKL-1 signaling

AA Sequence

MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE      1 - 70
RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK     71 - 140
CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQG    141 - 210
SGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQE    211 - 280
IVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFIN    281 - 350
PIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM    351 - 420
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE                                  421 - 460
//

Text Mined References (120)

PMID Year Title
26814197 2016 TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.
26602218 2016 Liver X Receptor Regulates Triglyceride Absorption Through Intestinal Down-regulation of Scavenger Receptor Class B, Type 1.
26450852 2015 Liver X receptor ligand cytotoxicity in colon cancer cells and not in normal colon epithelial cells depends on LXR? subcellular localization.
26434697 2015 Destabilization of the torsioned conformation of a ligand side chain inverts the LXR? activity.
26263968 2015 Combination of A? Secretion and Oxidative Stress in an Alzheimer-Like Cell Line Leads to the Over-Expression of the Nucleotide Excision Repair Proteins DDB2 and XPC.
26120082 2015 Broad Anti-tumor Activity of a Small Molecule that Selectively Targets the Warburg Effect and Lipogenesis.
26019035 The nuclear receptor FXR, but not LXR, up-regulates bile acid transporter expression in non-alcoholic fatty liver disease.
26009170 2015 Post-transcriptional regulation of gene expression by Unr.
25980575 2015 Activation of liver X receptors inhibits cadmium-induced apoptosis of human renal proximal tubular cells.
25661920 2015 CCAR2 negatively regulates nuclear receptor LXR? by competing with SIRT1 deacetylase.
25659329 2015 LXR agonist T0901317-Induced hyperlipidemia does not lead to lipid accumulation in the rat heart.
25124554 2014 Liver X receptor ? activation induces pyroptosis of human and murine colon cancer cells.
24863943 2014 A multigenic approach to evaluate genetic variants of PLCE1, LXRs, MMPs, TIMP, and CYP genes in gallbladder cancer predisposition.
24842676 2014 Levels of liver X receptors in testicular biopsies of patients with azoospermia.
24832115 2014 The medicinal chemistry of liver X receptor (LXR) modulators.
24618263 2015 Activation of liver X receptors inhibits experimental fibrosis by interfering with interleukin-6 release from macrophages.
24561505 2014 Structure of the retinoid X receptor ?-liver X receptor ? (RXR?-LXR?) heterodimer on DNA.
24398515 2014 Endothelial cellular senescence is inhibited by liver X receptor activation with an additional mechanism for its atheroprotection in diabetes.
24100084 2013 Lack of association between LXR? and LXR? gene polymorphisms and prevalence of metabolic syndrome: a case-control study of an Iranian population.
23987069 [Molecular modeling of interaction of 17(20)Z- and 17(20)E-pregna-5,17(20)-dien-21-oyl amides with the nuclear receptor LXRbeta].
23931754 2013 ABCA12 regulates ABCA1-dependent cholesterol efflux from macrophages and the development of atherosclerosis.
23867501 2013 LXR?/estrogen receptor-? signaling in lipid rafts preserves endothelial integrity.
23838803 2013 Association of liver X receptors (LXRs) genetic variants to gallbladder cancer susceptibility.
23686114 2013 Differential regulation of gene expression by LXRs in response to macrophage cholesterol loading.
23223141 2013 Liver X receptor activation inhibits melanogenesis through the acceleration of ERK-mediated MITF degradation.
23018104 2012 Activation of liver X receptor attenuates endothelin-1 expression in vascular endothelial cells.
22990668 2013 Activation of liver X receptors suppresses inflammatory gene expressions and transcriptional corepressor clearance in rheumatoid arthritis fibroblast like synoviocytes.
22766509 2012 Lipid metabolism and neuroinflammation in Alzheimer's disease: a role for liver X receptors.
22723445 2012 Liver X receptor activation reduces angiogenesis by impairing lipid raft localization and signaling of vascular endothelial growth factor receptor-2.
22610535 2013 The oxysterol receptors LXR? and LXR? suppress proliferation in the colon.
22367754 2012 Phospholipase A(2)-modified low-density lipoprotein activates liver X receptor in human macrophages.
22257474 2012 Liver X receptors bridge hepatic lipid metabolism and inflammation.
22029530 2011 A common polymorphism in NR1H2 (LXRbeta) is associated with preeclampsia.
22027013 2012 Genetic analysis of genes involved in amyloid-? degradation and clearance in Alzheimer's disease.
21951066 2011 The oxysterol 27-hydroxycholesterol regulates ?-synuclein and tyrosine hydroxylase expression levels in human neuroblastoma cells through modulation of liver X receptors and estrogen receptors--relevance to Parkinson's disease.
21937108 2011 RXR? and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21507939 2011 Liver X receptor beta (LXRbeta) interacts directly with ATP-binding cassette A1 (ABCA1) to promote high density lipoprotein formation during acute cholesterol accumulation.
21356276 2011 Liver X receptor-?/? expression ratio is increased in ACTH-secreting pituitary adenomas.
21315073 2011 CIDEA interacts with liver X receptors in white fat cells.
21268089 2011 Molecular mechanisms underlying the inhibition of IFN-?-induced, STAT1-mediated gene transcription in human macrophages by simvastatin and agonists of PPARs and LXRs.
21042792 2011 Genetic variation within the NR1H2 gene encoding liver X receptor ? associates with insulin secretion in subjects at increased risk for type 2 diabetes.
20939869 2010 Suggestive evidence of associations between liver X receptor ? polymorphisms with type 2 diabetes mellitus and obesity in three cohort studies: HUNT2 (Norway), MONICA (France) and HELENA (Europe).
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20836841 2010 Polymorphisms in NFkB, PXR, LXR and risk of colorectal cancer in a prospective study of Danes.
20655109 2010 Expression of liver X receptors in pregnancies complicated by preeclampsia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20364260 2010 LXR activation inhibits chemokine-induced CD4-positive lymphocyte migration.
20219900 2010 Activation of LXR increases acyl-CoA synthetase activity through direct regulation of ACSL3 in human placental trophoblast cells.
20176747 2010 Regulation of thyroid hormone activation via the liver X-receptor/retinoid X-receptor pathway.
20159957 2010 GPS2-dependent corepressor/SUMO pathways govern anti-inflammatory actions of LRH-1 and LXRbeta in the hepatic acute phase response.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19933273 2010 Nuclear receptor liver X receptor is O-GlcNAc-modified in response to glucose.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837721 2010 Liver X receptor in cholesterol metabolism.
19796621 2009 Liver X receptors and oxysterols promote ventral midbrain neurogenesis in vivo and in human embryonic stem cells.
19481530 2009 GPS2 is required for cholesterol efflux by triggering histone demethylation, LXR recruitment, and coregulator assembly at the ABCG1 locus.
19436111 2009 Liver X receptors contribute to the protective immune response against Mycobacterium tuberculosis in mice.
19426978 2009 LXR-activating oxysterols induce the expression of inflammatory markers in endothelial cells through LXR-independent mechanisms.
19303409 2009 Micellar lipid composition profoundly affects LXR-dependent cholesterol transport across CaCo2 cells.
19292929 2009 Functional and genetic analysis in type 2 diabetes of liver X receptor alleles--a cohort study.
19242521 2009 Induction of SREBP-1c mRNA by differentiation and LXR ligand in human keratinocytes.
19105208 2009 Liver X receptor mediates hepatitis B virus X protein-induced lipogenesis in hepatitis B virus-associated hepatocellular carcinoma.
19060904 2009 An empirical framework for binary interactome mapping.
18854425 2008 25-Hydroxycholesterol-3-sulfate regulates macrophage lipid metabolism via the LXR/SREBP-1 signaling pathway.
18782758 2008 Direct interaction of nuclear liver X receptor-beta with ABCA1 modulates cholesterol efflux.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18597895 2010 Gene-gene interaction between heme oxygenase-1 and liver X receptor-beta and Alzheimer's disease risk.
18221307 2008 Analysis of crystal structures of LXRbeta in relation to plasticity of the ligand-binding domain upon ligand binding.
18182682 2008 Thematic review series: skin lipids. Peroxisome proliferator-activated receptors and liver X receptors in epidermal biology.
18081155 2008 No association of genetic variants of liver X receptor-beta with Alzheimer's disease risk.
18026184 2008 NAT2 and NER genetic variants and sporadic prostate cancer susceptibility in African Americans.
17900622 2008 Interaction between CD14 and LXRbeta genes modulates Alzheimer's disease risk.
17845217 2007 Characterization of liver X receptor expression and function in human skin and the pilosebaceous unit.
17766241 2007 Novel role for the liver X nuclear receptor in the suppression of lung inflammatory responses.
17724434 2008 Liver X receptor is a key regulator of cytokine release in human monocytes.
17693624 2007 Liver X receptors inhibit human monocyte-derived macrophage foam cell formation by inhibiting fluid-phase pinocytosis of LDL.
17626048 2007 Elk1 and SRF transcription factors convey basal transcription and mediate glucose response via their binding sites in the human LXRB gene promoter.
17405904 2007 Liver X receptor stimulates cholesterol efflux and inhibits expression of proinflammatory mediators in human airway smooth muscle cells.
17396233 2007 Adipocyte fatty acid-binding protein (aP2), a newly identified LXR target gene, is induced by LXR agonists in human THP-1 cells.
17391100 2007 Molecular basis for repression of liver X receptor-mediated gene transcription by receptor-interacting protein 140.
17218271 2007 Parallel SUMOylation-dependent pathways mediate gene- and signal-specific transrepression by LXRs and PPARgamma.
17186944 2007 Selective up-regulation of LXR-regulated genes ABCA1, ABCG1, and APOE in macrophages through increased endogenous synthesis of 24(S),25-epoxycholesterol.
17135302 2007 ROS and NF-kappaB but not LXR mediate IL-1beta signaling for the downregulation of ATP-binding cassette transporter A1.
17110595 2006 A nuclear receptor corepressor-dependent pathway mediates suppression of cytokine-induced C-reactive protein gene expression by liver X receptor.
17108812 2006 Liver X receptor gene polymorphisms and adipose tissue expression levels in obesity.
17045963 2006 Expression of the human ABCC6 gene is induced by retinoids through the retinoid X receptor.
16973760 2007 Liver X receptors regulate adrenal steroidogenesis and hypothalamic-pituitary-adrenal feedback.
16904112 2006 Phosphorylation of the liver X receptors.
16567856 2006 Assessing the effects of LXR agonists on cellular cholesterol handling: a stable isotope tracer study.
16524875 2006 24(S)-hydroxycholesterol participates in a liver X receptor-controlled pathway in astrocytes that regulates apolipoprotein E-mediated cholesterol efflux.
16482468 2006 Activation of liver X receptors promotes lipid accumulation but does not alter insulin action in human skeletal muscle cells.
16354658 2006 A novel principle for partial agonism of liver X receptor ligands. Competitive recruitment of activators and repressors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16298468 Liver X receptor preferentially activates de novo lipogenesis in human preadipocytes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16141411 2005 Liver X receptor activation controls intracellular cholesterol trafficking and esterification in human macrophages.
15548517 2005 Adipocytic differentiation and liver x receptor pathways regulate the accumulation of triacylglycerols in human vascular smooth muscle cells.
15539633 2004 Liver X receptor agonists suppress vascular smooth muscle cell proliferation and inhibit neointima formation in balloon-injured rat carotid arteries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699103 2004 Transcription of the vascular endothelial growth factor gene in macrophages is regulated by liver X receptors.
14643652 2003 Crystal structure of the human liver X receptor beta ligand-binding domain in complex with a synthetic agonist.
12957674 2003 Transcriptional regulation of farnesyl pyrophosphate synthase by liver X receptors.
12819202 2003 The three-dimensional structure of the liver X receptor beta reveals a flexible ligand-binding pocket that can accommodate fundamentally different ligands.
12736258 2003 X-ray crystal structure of the liver X receptor beta ligand binding domain: regulation by a histidine-tryptophan switch.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393874 2002 Regulation of ALK-1 signaling by the nuclear receptor LXRbeta.
12198243 2002 The small heterodimer partner interacts with the liver X receptor alpha and represses its transcriptional activity.
12040022 2002 Regulation of cholesterol homeostasis by the liver X receptors in the central nervous system.
11546778 2001 Liver X receptor (LXR) regulation of the LXRalpha gene in human macrophages.
10187832 1999 Identification of a novel DNA binding site for nuclear orphan receptor OR1.
9874807 1999 Structural requirements of ligands for the oxysterol liver X receptors LXRalpha and LXRbeta.
9013544 1997 Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway.
7971966 1994 Ubiquitous receptor: a receptor that modulates gene activation by retinoic acid and thyroid hormone receptors.
7926814 1994 NER, a new member of the gene family encoding the human steroid hormone nuclear receptor.
7782080 1995 Assignment of the human ubiquitous receptor gene (UNR) to 19q13.3 using fluorescence in situ hybridization.
7760852 1995 Isolation of proteins that interact specifically with the retinoid X receptor: two novel orphan receptors.
7625741 1995 Ubiquitous receptor: structures, immunocytochemical localization, and modulation of gene activation by receptors for retinoic acids and thyroid hormones.