Property Summary

Ligand Count 4
NCBI Gene PubMed Count 26
PubMed Score 57.49
PubTator Score 96.37

Knowledge Summary

Patent (14,618)

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma 1.343 1.2e-03
adult high grade glioma -1.400 4.6e-03
Amyotrophic lateral sclerosis 1.219 1.4e-04
astrocytic glioma 1.200 3.3e-02
atypical teratoid / rhabdoid tumor -2.400 6.6e-06
Breast cancer 2.500 4.3e-02
breast carcinoma -1.100 2.7e-09
chronic kidney disease 1.100 4.5e-02
Crohn's disease -1.863 1.7e-03
cystic fibrosis -1.500 2.2e-05
ductal carcinoma in situ -1.100 3.2e-03
glioblastoma -1.700 5.8e-06
group 3 medulloblastoma -1.400 1.8e-02
intraductal papillary-mucinous adenoma (... 1.600 1.0e-02
invasive ductal carcinoma -1.130 2.7e-02
medulloblastoma, large-cell -1.600 2.0e-04
oligodendroglioma 1.300 1.4e-02
osteosarcoma 1.895 3.1e-03
ovarian cancer -1.700 3.5e-05
pancreatic cancer -1.300 4.1e-02
pancreatic carcinoma -1.300 4.1e-02
Pick disease 1.900 4.6e-05
primitive neuroectodermal tumor -1.500 4.0e-05
Rheumatoid arthritis 2.700 1.7e-03
ulcerative colitis -2.185 8.4e-04

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (11)

AA Sequence

MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKND      1 - 70
RIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKC     71 - 140
LKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQND    141 - 210
TLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQ    211 - 280
PQRGERIPKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY    281 - 350
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA    351 - 420
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFS    421 - 490
EKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD    491 - 560
LRSLNNMHSEELLAFKVHP                                                       561 - 579
//

Text Mined References (31)

PMID Year Title