Property Summary

Ligand Count 7
NCBI Gene PubMed Count 72
PubMed Score 81.56
PubTator Score 79.68

Knowledge Summary

Patent (5,540)

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.400 4.5e-04
Atopic dermatitis -1.200 1.9e-02
atypical teratoid/rhabdoid tumor -1.200 6.5e-07
breast carcinoma -1.500 2.1e-04
cutaneous lupus erythematosus -1.500 2.7e-03
ductal carcinoma in situ -1.300 3.8e-03
group 3 medulloblastoma -1.200 8.9e-03
invasive ductal carcinoma -1.400 3.3e-03
osteosarcoma -2.171 1.0e-04
posterior fossa group B ependymoma -1.100 3.9e-08
primitive neuroectodermal tumor -1.200 3.3e-03
psoriasis -1.600 2.2e-16
spina bifida -1.111 4.1e-02
subependymal giant cell astrocytoma -1.063 2.3e-02
tuberculosis and treatment for 3 months 1.200 9.4e-06

Gene RIF (52)

AA Sequence

MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGS      1 - 70
IPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVAS     71 - 140
GFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPK    141 - 210
REKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPS    211 - 280
PEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQR    281 - 350
HNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM    351 - 420
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNV    421 - 490
KDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVE    491 - 560
QLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ                    561 - 614
//

Text Mined References (80)

PMID Year Title