Property Summary

NCBI Gene PubMed Count 68
PubMed Score 75.30
PubTator Score 79.68

Knowledge Summary

Patent (5,540)

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 2.7e-03
osteosarcoma -2.171 1.0e-04
group 3 medulloblastoma -1.800 5.3e-04
primitive neuroectodermal tumor -1.200 3.3e-03
Atopic dermatitis -1.200 1.9e-02
adrenocortical carcinoma 1.400 4.5e-04
tuberculosis and treatment for 6 months 1.500 5.7e-07
breast carcinoma -1.500 2.1e-04
atypical teratoid/rhabdoid tumor -1.200 6.5e-07
posterior fossa group B ependymoma -1.100 3.9e-08
psoriasis -2.200 7.7e-09
subependymal giant cell astrocytoma -1.063 2.3e-02
spina bifida -1.111 4.1e-02
ductal carcinoma in situ -1.300 3.8e-03
invasive ductal carcinoma -1.400 3.3e-03

Protein-protein Interaction (3)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (50)

PMID Text
26392558 Data show that ubiquitin E3 ligase Siah2 depletion delays circadian degradation of nuclear hormone receptor RevErbalpha (Nr1d1) and lengthens period length.
25969949 Highly quantitative fluorescence anisotropy assays in competition mode revealed that the rev-erbA-alpha specificity for the NCoR corepressor lies in the first two residues of the beta-strand in Interaction Domain 1 of NCoR.
25798852 the role of NR1D1 polymorphisms in the regulation of Nuclear receptor REV-ERBalpha and circadian rhythms regulation
25789810 associations between NR1D1, RORA and RORB genes and bipolar disorder.(
25365257 CRY2 and REV-ERB ALPHA as the clock genes upregulated in obesity during the 24 h period and that REV-ERB ALPHA is an important gene associated with MS.
25089907 Our results suggest that the REV-ERB ALPHA rs939347 polymorphism could modulate body fat mass in men. The present work supports the role of REV-ERB ALPHA in the development of obesity as well as a potential target for the treatment of obesity
24677802 Using free-energy simulations, the study shows that rev-erbA-alpha-induced DNA deformation preferentially occurs by induced fit rather than by conformational selection, even though the DNA is only slightly distorted in the complex.
24497272 Rev-erbalpha is a novel regulator of hepatic stellate cell transdifferentation
24311788 apoA-IV inhibits hepatic gluconeogenesis by decreasing Glc-6-Pase and PEPCK gene expression through NR1D1.
23449984 Rev-erbalpha bestows protection against mycobacterial infection by direct gene repression of IL10 and thus provide a novel target in modulating macrophage microbicidal properties.
23398316 DBC1 modulates the stability and function of the nuclear receptor Rev-erb-alpha.
23083441 A haplotype block in REV-ERBalpha was associated with white matter lesion volumes in the Rotterdam Study I.
22538398 Genetic variants of NR1D1 associate with bipolar disorder.
22224817 Thyroid hormone receptor-alpha/NR1D1 polymorphisms were not associated with baseline characteristics, including serum TSH and free thyroxine. None of the polymorphisms were associated with bone mineral density or osteoporotic fractures.
22024429 in situ hybridization revealed that RORA and NR1D1 were expressed in human endometrial stromal and epithelial cells
21479263 REV-ERBalpha plays a dual role in regulation of the activity of the BMAL1/CLOCK heterodimer by regulation of expression of both the BMAL1 and CLOCK genes.
20817722 Data demonstrate that NPAS2 is also a RORalpha and REV-ERBalpha target gene.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20581824 Study reports the crystal structure of a nuclear receptor-co-repressor (N-CoR) interaction domain 1 (ID1) peptide bound to truncated human Rev-erbalpha ligand-binding domain.
20534529 Arf-bp1 and Pam are novel regulators of circadian gene expression that target Rev-erb alpha for degradation
20396431 Observational study of gene-disease association. (HuGE Navigator)
20348464 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
20160030 Results show that the cells of this aggressive form of breast cancer are genetically preprogrammed to depend on NR1D1 and PBP for the energy production necessary for survival.
20072116 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19818381 While negative, our findings do not exclude an involvement of DGKH and NR1D1 in lithium prophylaxis.
19818381 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19710360 Rev-erbalpha modulates the synthesis of its own ligand in a negative feedback pathway that maintains heme levels and regulates cellular energy metabolism.
19696364 Review. We propose that the nuclear receptor and core clock component Rev-erb-alpha behaves as a gatekeeper to timely coordinate the circadian metabolic response.
19693801 Observational study of gene-disease association. (HuGE Navigator)
19267705 This study indicated a nominal association of the REV-ERBalpha gene with bipolar disorder, suggest a possible role of REV-ERBalpha in the pathogenesis of bipolar disorder.
19267705 Observational study of gene-disease association. (HuGE Navigator)
18804497 This study suggests that NR1D1 does not play a major role in the pathophysiology of mood disorders in the Japanese population.
18804497 Observational study of gene-disease association. (HuGE Navigator)
18511497 These data identify Rev-erbalpha as a new LXR target gene, inhibiting LXR-induction of TLR-4 in a negative transcriptional feedback loop, but not cholesterol homeostasis gene expression.
18228528 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18227153 Rev-erbalpha protein levels must rise and then fall for adipocyte differentiation to occur. Stable expression of Rev-erb protein prevents induction of PPARgamma2.
18037887 heme regulation of REV-ERBs may link the control of metabolism and the mammalian clock
18006707 findings show that rev-erbalpha serves as a heme sensor that coordinates the cellular clock, glucose homeostasis, and energy metabolism
17075855 Rev-ErbAalpha is highly expressed in osteoarthritis articular chondrocytes and that its expression is modulated by known cartilage catabolic and anabolic stimuli
16484495 findings show that GSK3beta phosphorylates and stabilizes Rev-erbalpha, a negative component of the circadian clock; control of Rev-erbalpha protein stability is a critical component of the peripheral clock and a biological target of lithium therapy
15761026 the N-CoR/HDAC3 complex has a role in regulating the expression of genes involved in circadian rhythm by functioning as corepressor for Rev-erbalpha
15013753 Overexpression of EAR1 upregulated expression of IL6 and COX2, and increased transactivation by NFKB and nuclear translocation of p65 in A7r5 VSMCs. The expression of EAR1 was upregulated by RORalpha1 but that upregulation was attenuated by EAR1 itself
12821652 Rev-Erbalpha as a target gene of PPARgamma in adipose tissue and demonstrate a role for this nuclear receptor as a promoter of adipocyte differentiation.
12683943 Data show that Rev-erb alpha and beta contain a functional nuclear location signal in the DNA-binding domain, and suggest that they control their intracellular localization via a mechanism different from that of other nuclear receptors.
12377782 hRev-erbalpha plays a key role in hRORalpha1 action
12114512 ROR(alpha) and Reverb(alpha) are expressed with a similar tissue distribution and are both induced during the differentiation of rat L6 myoblastic cells
12021280 novel physiological role for members of the Rev-erb family of nuclear receptors in the regulation of genes involved in triglyceride metabolism and the pathogenesis of atherosclerosis

AA Sequence

MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGS      1 - 70
IPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVAS     71 - 140
GFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPK    141 - 210
REKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPS    211 - 280
PEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQR    281 - 350
HNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM    351 - 420
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNV    421 - 490
KDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVE    491 - 560
QLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ                    561 - 614
//

Text Mined References (76)

PMID Year Title
26392558 2015 Ubiquitin ligase Siah2 regulates RevErb? degradation and the mammalian circadian clock.
25969949 2015 Molecular mechanisms of transcriptional control by Rev-erb?: An energetic foundation for reconciling structure and binding with biological function.
25798852 2015 Associations between polymorphisms in the NR1D1 gene encoding for nuclear receptor REV-ERB? and circadian typologies.
25789810 2015 Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.
25365257 2014 Altered clock gene expression in obese visceral adipose tissue is associated with metabolic syndrome.
25089907 2014 REV-ERB ALPHA polymorphism is associated with obesity in the Spanish obese male population.
24677802 2014 RevErb? preferentially deforms DNA by induced fit.
24497272 2014 Novel role of nuclear receptor Rev-erb? in hepatic stellate cell activation: potential therapeutic target for liver injury.
24415752 2014 Deleted in breast cancer 1 (DBC1) protein regulates hepatic gluconeogenesis.
24311788 2014 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23449984 2013 Human IL10 gene repression by Rev-erb? ameliorates Mycobacterium tuberculosis clearance.
23398316 2013 DBC1 (Deleted in Breast Cancer 1) modulates the stability and function of the nuclear receptor Rev-erb?.
23083441 2012 The thyroid hormone receptor alpha locus and white matter lesions: a role for the clock gene REV-ERB?.
22682217 2012 REV-ERBs: more than the sum of the individual parts.
22613952 2012 REV-ERB-erating nuclear receptor functions in circadian metabolism and physiology.
22538398 2012 Clock gene variants in mood and anxiety disorders.
22224817 2012 A large-scale population-based analysis of common genetic variation in the thyroid hormone receptor alpha locus and bone.
22184247 2012 The nuclear receptor REV-ERB? mediates circadian regulation of innate immunity through selective regulation of inflammatory cytokines.
22170608 2011 Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.
22024429 2012 Expression of retinoic acid-related orphan receptor alpha and its responsive genes in human endometrium regulated by cholesterol sulfate.
21874017 2011 A circadian clock in hippocampus is regulated by interaction between oligophrenin-1 and Rev-erb?.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21628546 2011 Modulation of clock gene expression by the transcriptional coregulator receptor interacting protein 140 (RIP140).
21479263 2011 Direct regulation of CLOCK expression by REV-ERB.
20817722 2010 Characterization of the core mammalian clock component, NPAS2, as a REV-ERBalpha/RORalpha target gene.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20581824 2010 Structure of Rev-erbalpha bound to N-CoR reveals a unique mechanism of nuclear receptor-co-repressor interaction.
20534529 2010 E3 ligases Arf-bp1 and Pam mediate lithium-stimulated degradation of the circadian heme receptor Rev-erb alpha.
20414452 2010 Nuclear receptor Rev-erbalpha: a heme receptor that coordinates circadian rhythm and metabolism.
20396431 2010 Genotyping sleep disorders patients.
20348464 2010 Nuclear receptor rev-erb-{alpha} circadian gene variants and lithium carbonate prophylaxis in bipolar affective disorder.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20160030 2010 An RNA interference screen identifies metabolic regulators NR1D1 and PBP as novel survival factors for breast cancer cells with the ERBB2 signature.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
20070857 2010 Transcriptional repressor TIEG1 regulates Bmal1 gene through GC box and controls circadian clockwork.
19955433 2009 The nuclear receptor ROR(alpha) exerts a bi-directional regulation of IL-6 in resting and reactive astrocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19818381 2009 Interacting genes in lithium prophylaxis: preliminary results of an exploratory analysis on the role of DGKH and NR1D1 gene polymorphisms in 199 Sardinian bipolar patients.
19710360 2009 Negative feedback maintenance of heme homeostasis by its receptor, Rev-erbalpha.
19696364 2009 Rev-erb-alpha: an integrator of circadian rhythms and metabolism.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19267705 2009 Association study in a Sardinian sample between bipolar disorder and the nuclear receptor REV-ERBalpha gene, a critical component of the circadian clock system.
18804497 2008 Association analysis of nuclear receptor Rev-erb alpha gene (NR1D1) with mood disorders in the Japanese population.
18511497 2008 The nuclear receptor Rev-erbalpha is a liver X receptor (LXR) target gene driving a negative feedback loop on select LXR-induced pathways in human macrophages.
18228528 2008 Clock genes may influence bipolar disorder susceptibility and dysfunctional circadian rhythm.
18227153 2008 Bifunctional role of Rev-erbalpha in adipocyte differentiation.
18037887 2007 Identification of heme as the ligand for the orphan nuclear receptors REV-ERBalpha and REV-ERBbeta.
18006707 2007 Rev-erbalpha, a heme sensor that coordinates metabolic and circadian pathways.
17892483 2007 A zinc finger HIT domain-containing protein, ZNHIT-1, interacts with orphan nuclear hormone receptor Rev-erbbeta and removes Rev-erbbeta-induced inhibition of apoCIII transcription.
17075855 2006 Functional characterization of an orphan nuclear receptor, Rev-ErbAalpha, in chondrocytes and its potential role in osteoarthritis.
16968709 2006 The orphan nuclear receptor Rev-erb alpha regulates circadian expression of plasminogen activator inhibitor type 1.
16484495 2006 Nuclear receptor Rev-erbalpha is a critical lithium-sensitive component of the circadian clock.
15761026 2005 The orphan nuclear receptor Rev-erbalpha recruits the N-CoR/histone deacetylase 3 corepressor to regulate the circadian Bmal1 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15190009 2004 Photoreceptor-specific nuclear receptor NR2E3 functions as a transcriptional activator in rod photoreceptors.
15013753 2004 Rev-erbalpha upregulates NF-kappaB-responsive genes in vascular smooth muscle cells.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12821652 2003 The orphan nuclear receptor Rev-Erbalpha is a peroxisome proliferator-activated receptor (PPAR) gamma target gene and promotes PPARgamma-induced adipocyte differentiation.
12683943 2003 A specific and unusual nuclear localization signal in the DNA binding domain of the Rev-erb orphan receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454280 2002 Identification of Rev-erbalpha as a physiological repressor of apoC-III gene transcription.
12377782 2002 Transcriptional regulation of human Rev-erbalpha gene expression by the orphan nuclear receptor retinoic acid-related orphan receptor alpha.
12114512 2002 Identification of Reverb(alpha) as a novel ROR(alpha) target gene.
12021280 2002 Orphan nuclear hormone receptor Rev-erbalpha regulates the human apolipoprotein CIII promoter.
11669620 2001 DNA deformability as a recognition feature in the reverb response element.
9660968 1998 Structural elements of an orphan nuclear receptor-DNA complex.
9482666 1998 Identification and characterization of a novel corepressor interaction region in RVR and Rev-erbA alpha.
8948627 1996 Two receptor interaction domains in the corepressor, N-CoR/RIP13, are required for an efficient interaction with Rev-erbA alpha and RVR: physical association is dependent on the E region of the orphan receptors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8622974 1996 A functional Rev-erb alpha responsive element located in the human Rev-erb alpha promoter mediates a repressing activity.
2539258 1989 Two erbA homologs encoding proteins with different T3 binding capacities are transcribed from opposite DNA strands of the same genetic locus.
1971514 1990 Isolation of a cDNA encoding human Rev-ErbA alpha: transcription from the noncoding DNA strand of a thyroid hormone receptor gene results in a related protein that does not bind thyroid hormone.
1850510 1991 Genomic organization of the human thyroid hormone receptor alpha (c-erbA-1) gene.