Property Summary

NCBI Gene PubMed Count 108
PubMed Score 550.45
PubTator Score 250.13

Knowledge Summary

Patent (41,489)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.900 3.1e-32
pancreatic cancer -1.200 1.5e-03

Protein-protein Interaction (3)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (89)

PMID Text
26553876 Data suggest that LRH1/NR5A2 (liver receptor homologue-1) exhibits phospholipid-mediated allosteric control of protein-protein binding interface in interactions with TIF2 (co-activator; transcription intermediary factor 2) and SHP.
26421305 These findings show that POD-1/TCF21 regulates SF-1 and LRH-1 by distinct mechanisms, contributing to the understanding of POD-1 involvement and its mechanisms of action in adrenal and liver tumorigenesis.
25976932 Overexpression of SHP and activation of AMPK reverses profibrogenic features of HCV-infected cells by decreasing TGF-beta and fibrotic gene expression.
25720568 At the molecular level, estrogen upregulated hepatic SHP expression through binding to its proximal promoter. In addition, the roles of estrogen were largely blunted in mice with SHP deficiency.
25655831 These data are suggestive of a role for SHP in controlling NLRP3 inflammasome activation through a mechanism involving interaction with NLRP3 and maintenance of mitochondrial homeostasis.
25015078 These results establish SHP as a novel antihypertrophic regulator that acts by interfering with GATA6 signaling.
24619556 E2F1 transcription factor activates early growth response (Egr)-1 promoter which is repressed by SHP and EIA-like inhibitor of differentiation (EID)1.
24379397 An unexpected EID1-binding site on SHP is located at the N terminus of the receptor, where EID1 mimics helix H1 of the nuclear receptor ligand-binding domain.
24365583 Activation of the VDR represses hepatic SHP to increase levels of CYP7A1 and reduce cholesterol.
24343129 SHP regulates PDCD5-mediated apoptosis in cancer cells
24318876 SHP repressed HNF4alpha transactivation of CYP2D6 promoter.
23874642 These results indicate that the N-terminal domain of SHP is important for its nuclear translocation via HNF4alpha.
23824184 This study identifies PKCzeta as a novel key upstream regulator of BA-regulated SHP function, revealing the role of Thr-55 phosphorylation in epigenomic regulation of liver metabolism.
23042943 Lentivirus-mediated exogenous FXR expression resulted in a marked increase of small heterodimer partner expression, significant repression of liver cancer cell proliferation.
23038264 HNF4alpha and LRH-1 promote active transcription histone marks on the Cyp7a1 promoter that are reversed by FGF19 in a SHP-dependent manner
23010719 SHP is a downstream factor of BMP2 signaling in odontoblasts and may stimulate dentin matrix mineralization via enhancing the transcriptional activity of Dlx5.
22977252 NR0B2 physically interacted with STAT5 and inhibited STAT5 recruitment on the PEPCK gene promoter.
22737255 Overexpression of p53 causes rapid SHP protein degradation, which does not require the presence of Mdm2 and is mediated by the proteosome pathway
22362755 In human hepatocellular carcinoma, increased DNMT1 expression is negatively correlated with SHP levels.
22314666 Shp is a target for miR-141 and it is downregulated in cultured human PCa cells with the involvement of upregulation of miR-141, which promotes AR transcriptional activity.
22292081 The impact of loss of SHP protein may be even more pronounced in fibrolamellar carcinoma than in a typical form of hepatocellular carcinoma.
22171277 FXR and SHP play a limited role in modulating HBV biosynthesis.
21725089 control network for Egr-1 expression through a feedback loop between SHP and HNF4alpha.
21459093 Study provides evidence for nuclear receptor mediated regulation of Dnmt1 expression through ERRgamma and SHP crosstalk.
21262773 The activity of SHP is also increased by posttranslational methylation at Arg-57 by protein arginine methyltransferase 5 (PRMT5).
20882396 mutagenesis experiments whose preliminary data suggest the presence of a functional site in SHP as defined by residues Phe96, Arg138 and Arg238
20853064 NR0B2/SHP expression level was significantly decreased in human liver cancer but not in normal liver
20734064 Observational study of gene-disease association. (HuGE Navigator)
20516075 genetic variations in SHP are common among human subjects; the Lys-170 residue plays a key role in controlling SHP ubiquitination and acetylation associated with SHP protein stability and repressive function
20346360 Observational study of gene-disease association. (HuGE Navigator)
20233523 Mutations of the small heterodimer partner gene is associated with obesity and type 2 diabetes.
20175750 SHP overexpression decreased the expression of Gli target genes and SHP knockdown increased the expression of these genes. The results suggest that SHP can play a negative role in Hedgehog/Gli1 signalling.
19793822 The effects of PGC1alpha and SHP on hepatitis B viral biosynthesis in the human hepatoma cell line Huh7 were similar to those observed in the nonhepatoma cells expressing ERRalpha and ERRgamma.
19793803 PGC1alpha and SHP modulated hepatitis B viral biosynthesis differently in the human hepatoma cell lines HepG2 and Huh7, indicating distinct modes of transcriptional regulation.
19720831 a novel signaling pathway inhibits hepatic gluconeogenesis through HGF/AMPK/USF-1/SHP
19509248 Resullts show that SHP and Sin3A play an important role in adamantyl-substituted retinoid-related induction of cellular apoptosis.
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19372104 Bile acids inhibit duodenal secretin expression via orphan nuclear receptor small heterodimer partner (SHP).
19366697 A mechanism for LXRalpha in controlling the gene expression of LGK that involves activation through SREBP-1c and PPARgamma and inhibition through SHP, is proposed.
19322021 SHP induced the cell cycle regulatory protein levels and cooperatively increased an induction of p21WAF1 expression with p65.
18842595 p300 acts as a critical coactivator of FXR induction of SHP by acetylating histones at the promoter and FXR itself
18781616 Mutations in SHP associated with mild obesity in childhood increase susceptibility to type 2 diabetes in later life in Japanese patients.
18781616 Observational study of gene-disease association. (HuGE Navigator)
18775915 bile acid induces an increase in the gene expression of COX-2 via the sequential transcriptional induction of SHP and CDX1 in precancerous lesions of human gastric cancer.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18657049 These results indicate that SMILE isoforms regulate the inhibition of estrogen receptor transactivation by SHP in a cell-type-specific manner and act as a novel transcriptional co-regulator in ER signalling.
18459945 Data have shown that SHP represses the transcriptional activity of hepatocyte nuclear factor-6 that serves as a novel target in the regulation of gluconeogenesis.
18385139 PGC-1alpha is an important co-activator for LRH-1 and that SHP targets the interaction between LRH-1 and PGC-1alpha to inhibit CYP7A1 expression.
18325392 Propose that SHP functions as a novel tumor suppressor in the development of heptaocellular carcinoma.
18307978 These results indicate that bile acid performs a critical function in the regulation of the induction of inflammatory-related genes in gastric cells
18276794 SHP-1 acts as a sensor for hydroxynonenal and is responsible for an adaptive response to oxidative stress in respiratory epithetlium.
18234786 Small heterodimer partner (SHP), an orphan nuclear hormone receptor lacking a DNA binding domain, inhibits nuclear hormone receptor-mediated hepatitis B viral transcription and replication.
18187620 Knockdown of nuclear receptor subfamily 0, group B, member 2 (NR0B2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17910058 LRH-1/phospholipid and LRH-1/SHP (fragments) interactions are analyzed by counting atomic contact number, identifying hydrogen bonds, and estimating binding free energies
17909097 Metformin inhibits hepatic gluconeogenesis through AMPK-dependent regulation of SHP.
17646707 The repressive functions of SHP and DAX-1 have been conserved in fish and mammals although with different transcriptional targets and mechanisms.
17522048 LRH-1 stimulation of the FAS LXR response is blocked by the addition of small heterodimer partner (SHP) and that FAS mRNA
17289919 New roles for SHP in testicular androgen and retinoic acid metabolism, making SHP a testicular gatekeeper of the timing of male sexual maturation.
17145766 These studies establish a critical role for G9a methyltransferase, histone deacetylases, and the Swi/Snf-Brm complex in the SHP-mediated inhibition of hepatic bile acid synthesis via coordinated chromatin modification at target genes.
17094771 results suggest that SHP might regulate a level of hepatic gluconeogenesis driven by C/EBPalpha activation
17074765 SHP is a novel co-regulator of Smad3 that regulates TGF-beta signaling
16825495 Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.
16762922 both SHP-1 and SHP-2 have a positive role in epidermal growth factor-induced ERK1/2 activation and they act cooperatively rather than antagonistically.
16709599 DAX1 and small heterodimer partner (SHP) form homodimers individually, as well as DAX1-SHP heterodimers suggesting the possibility of novel functions independent of their coregulator roles.
16282330 LRH-1 and SHP1 regulate 3-hydroxy-3-methylglutaryl coenzyme A reductase promoter and have a role in regulation of cholesterol synthesis and uptake
16123152 The GR/dexamethasone activation of the hNTCP promoter is counteracted by bile acids and small heterodimer partner, providing a negative feedback mechanism for bile acid uptake in human hepatocytes.
15973435 SHP affects genes involved in diverse biological pathways, e.g., several key genes involved in consecutive steps of cholesterol degradation, bile acid conjugation, transport and lipogenic pathways.
15723037 crystal structure at 1.9 A resoluation of the ligand-binding domain of hLRH-1 in complex with the NR box 1 motif of human SHP, which contacts the AF-2 region of hLRH-1 using selective structural motifs
15459958 Observational study of gene-disease association. (HuGE Navigator)
15459958 SHP mutations found in obese Danish men
15358835 NR0B2 is involved in the regulation of G6Pase, CYP7A1, and PEPCK gene expression via novel mechanism of inhibition of HNF3 activity and expand the role of NR0B2 as a coregulator of other family of transcription factors in addition to nuclear receptors.
15314177 Results suggest that SHP mediates recruitment of mSin3A-Swi/Snf to the CYP7A1 promoter, resulting in chromatin remodeling and gene repression.
15292277 c-Jun works to activate the expression of SHP genes associated with the cascade regulation of monocytic differentiation.
15269224 SHP-1 tyrosine phosphatase is regulated in human platelets by serine phosphorylation at its C terminus
15202934 PGC-1alpha mediates the ligand-dependent activation of FXR and transcription of SHP gene.
15123650 orphan nuclear receptor small heterodimer partner promoter is regulated by sterol regulatory element binding protein-1
14762685 At diagnosis, methylation of SHP1 occurred more frequently in acute myeloid leukaemia than acute lymphoblastic leukaemia. Frequent methylation of SHP1, but not SOCS1, may be important in the pathogenesis, but not prognosis, of acute leukaemias
14752053 Acts as a novel corepressor for basic helix-loop-helix transcription factor BETA2/NeuroD
14672953 results suggest that bile acids negatively regulate the human angiotensinogen gene through the inhibitory effect of small heterodimer partner on hepatocyte nuclear factor-4
14627819 basic helix-loop-helix (bHLH) transcription factors, the E2A proteins (E47, E12 and E2/5), activated the human but not the mouse SHP promoter
14593077 Modulation of SHP expression and/or activity in adipose tissue may therefore have significant effects on aromatase expression and estrogen production in breast adipose tissue.
12842887 orphan receptor small heterodimer partner expression is regulated by estrogen receptor alpha
12716767 Observational study of gene-disease association. (HuGE Navigator)
12716767 the relation between genetic variation in SHP and birth weight, adiposity, and insulin levels in three independent populations
12716764 Observational study of gene-disease association. (HuGE Navigator)
12324453 SHP has a role in modulating hepatic glucocorticoid action
12198243 SHP is able to interact with LXR and to modulate its transcriptional activity.
12181644 polymorphisms in the human SHP1 gene; found no rare SHP1 coding sequence variants that were exclusive to patients with lipodystrophy
11136233 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREALDVLAKTVAFL      1 - 70
RNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQ     71 - 140
PSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLCEVLEPWCPAA    141 - 210
QGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLLGDMLLLR                           211 - 257
//

Text Mined References (108)

PMID Year Title
26553876 2016 Unexpected Allosteric Network Contributes to LRH-1 Co-regulator Selectivity.
26421305 2015 POD-1/TCF21 Reduces SHP Expression, Affecting LRH-1 Regulation and Cell Cycle Balance in Adrenocortical and Hepatocarcinoma Tumor Cells.
25976932 2015 Small heterodimer partner attenuates profibrogenic features of hepatitis C virus-infected cells.
25720568 2015 Hepatic estrogen receptor ? improves hepatosteatosis through upregulation of small heterodimer partner.
25655831 2015 Small heterodimer partner interacts with NLRP3 and negatively regulates activation of the NLRP3 inflammasome.
25015078 2014 Small heterodimer partner blocks cardiac hypertrophy by interfering with GATA6 signaling.
24619556 2014 E2F1 is a novel fibrogenic gene that regulates cholestatic liver fibrosis through the Egr-1/SHP/EID1 network.
24379397 2014 Structural insights into gene repression by the orphan nuclear receptor SHP.
24365583 2014 Vitamin D receptor activation down-regulates the small heterodimer partner and increases CYP7A1 to lower cholesterol.
24343129 2014 NF-?B p65 recruited SHP regulates PDCD5-mediated apoptosis in cancer cells.
24318876 2014 Altered expression of small heterodimer partner governs cytochrome P450 (CYP) 2D6 induction during pregnancy in CYP2D6-humanized mice.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23874642 2013 Characterization of the mitochondrial localization of the nuclear receptor SHP and regulation of its subcellular distribution by interaction with Bcl2 and HNF4?.
23824184 2013 Bile acid signal-induced phosphorylation of small heterodimer partner by protein kinase C? is critical for epigenomic regulation of liver metabolic genes.
23042943 2012 Downregulation of nuclear receptor FXR is associated with multiple malignant clinicopathological characteristics in human hepatocellular carcinoma.
23038264 2012 Nuclear receptors HNF4? and LRH-1 cooperate in regulating Cyp7a1 in vivo.
23010719 2012 SHP is involved in BMP2-induced odontoblast differentiation.
22977252 2012 Orphan nuclear receptor small heterodimer partner negatively regulates growth hormone-mediated induction of hepatic gluconeogenesis through inhibition of signal transducer and activator of transcription 5 (STAT5) transactivation.
22737255 2012 Cross-regulation of protein stability by p53 and nuclear receptor SHP.
22575647 2012 An autoregulatory feedback loop between Mdm2 and SHP that fine tunes Mdm2 and SHP stability.
22362755 2012 Zinc-induced Dnmt1 expression involves antagonism between MTF-1 and nuclear receptor SHP.
22314666 2012 miR-141 modulates androgen receptor transcriptional activity in human prostate cancer cells through targeting the small heterodimer partner protein.
22292081 2012 Loss of the orphan nuclear receptor SHP is more pronounced in fibrolamellar carcinoma than in typical hepatocellular carcinoma.
22171277 2012 Limited effects of bile acids and small heterodimer partner on hepatitis B virus biosynthesis in vivo.
21725089 2011 Diurnal regulation of the early growth response 1 (Egr-1) protein expression by hepatocyte nuclear factor 4alpha (HNF4alpha) and small heterodimer partner (SHP) cross-talk in liver fibrosis.
21459093 2011 Nuclear receptor SHP inhibition of Dnmt1 expression via ERR?.
21262773 2011 Arginine methylation by PRMT5 at a naturally occurring mutation site is critical for liver metabolic regulation by small heterodimer partner.
20882396 2010 Insights into the binding mode and mechanism of action of some atypical retinoids as ligands of the small heterodimer partner (SHP).
20853064 2010 Systems-level analysis of gene expression data revealed NR0B2/SHP as potential tumor suppressor in human liver cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20516075 2010 Novel polymorphisms of nuclear receptor SHP associated with functional and structural changes.
20375098 2010 Transcriptional corepressor SHP recruits SIRT1 histone deacetylase to inhibit LRH-1 transactivation.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20233523 Gender-dependent penetrance of small heterodimer partner (SHP) gene deficiency in overweight/obese Chinese pedigrees.
20175750 2010 SHP (small heterodimer partner) suppresses the transcriptional activity and nuclear localization of Hedgehog signalling protein Gli1.
19793822 2009 Peroxisome proliferator-activated receptor gamma Coactivator 1alpha and small heterodimer partner differentially regulate nuclear receptor-dependent hepatitis B virus biosynthesis.
19793803 2009 Distinct regulation of hepatitis B virus biosynthesis by peroxisome proliferator-activated receptor gamma coactivator 1alpha and small heterodimer partner in human hepatoma cell lines.
19720831 2009 Hepatocyte growth factor family negatively regulates hepatic gluconeogenesis via induction of orphan nuclear receptor small heterodimer partner in primary hepatocytes.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19509248 2009 SHP and Sin3A expression are essential for adamantyl-substituted retinoid-related molecule-mediated nuclear factor-kappaB activation, c-Fos/c-Jun expression, and cellular apoptosis.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19372104 2009 Bile acids inhibit duodenal secretin expression via orphan nuclear receptor small heterodimer partner (SHP).
19366697 2009 Interrelationship between liver X receptor alpha, sterol regulatory element-binding protein-1c, peroxisome proliferator-activated receptor gamma, and small heterodimer partner in the transcriptional regulation of glucokinase gene expression in liver.
19322021 2009 The orphan nuclear receptor SHP inhibits apoptosis during the monocytic differentiation by inducing p21WAF1.
19085950 2009 Bile acids activate fibroblast growth factor 19 signaling in human hepatocytes to inhibit cholesterol 7alpha-hydroxylase gene expression.
18842595 2008 The p300 acetylase is critical for ligand-activated farnesoid X receptor (FXR) induction of SHP.
18781616 2008 Mutations in the small heterodimer partner gene increase morbidity risk in Japanese type 2 diabetes patients.
18775915 2008 Bile acid induces expression of COX-2 through the homeodomain transcription factor CDX1 and orphan nuclear receptor SHP in human gastric cancer cells.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18657049 2008 SMILE, a new orphan nuclear receptor SHP-interacting protein, regulates SHP-repressed estrogen receptor transactivation.
18459945 2008 Orphan nuclear receptor SHP interacts with and represses hepatocyte nuclear factor-6 (HNF-6) transactivation.
18385139 2008 Peroxisome proliferator-activated receptor-gamma coactivator-1alpha activation of CYP7A1 during food restriction and diabetes is still inhibited by small heterodimer partner.
18325392 2008 Epigenetic inhibition of nuclear receptor small heterodimer partner is associated with and regulates hepatocellular carcinoma growth.
18307978 2008 Bile acid regulates c-Jun expression through the orphan nuclear receptor SHP induction in gastric cells.
18276794 2008 SHP-1 inhibition by 4-hydroxynonenal activates Jun N-terminal kinase and glutamate cysteine ligase.
18234786 2008 Differential inhibition of nuclear hormone receptor-dependent hepatitis B virus replication by the small heterodimer partner.
17910058 2008 Molecular dynamics simulation study for LRH-1: interaction with fragments of SHP and function of phospholipid ligand.
17909097 2008 Metformin inhibits hepatic gluconeogenesis through AMP-activated protein kinase-dependent regulation of the orphan nuclear receptor SHP.
17686645 LXXLL motifs and AF-2 domain mediate SHP (NR0B2) homodimerization and DAX1 (NR0B1)-DAX1A heterodimerization.
17646707 2007 Distinct repressive properties of the mammalian and fish orphan nuclear receptors SHP and DAX-1.
17522048 2007 A key role for orphan nuclear receptor liver receptor homologue-1 in activation of fatty acid synthase promoter by liver X receptor.
17289919 2007 The small heterodimer partner is a gonadal gatekeeper of sexual maturation in male mice.
17145766 2007 Coordinated recruitment of histone methyltransferase G9a and other chromatin-modifying enzymes in SHP-mediated regulation of hepatic bile acid metabolism.
17094771 2007 Transcriptional repression of the gluconeogenic gene PEPCK by the orphan nuclear receptor SHP through inhibitory interaction with C/EBPalpha.
17074765 2006 Orphan nuclear receptor small heterodimer partner inhibits transforming growth factor-beta signaling by repressing SMAD3 transactivation.
16825495 2006 Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.
16762922 2006 Antagonism or synergism. Role of tyrosine phosphatases SHP-1 and SHP-2 in growth factor signaling.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16709599 2006 Dosage-sensitive sex reversal adrenal hypoplasia congenita critical region on the X chromosome, gene 1 (DAX1) (NR0B1) and small heterodimer partner (SHP) (NR0B2) form homodimers individually, as well as DAX1-SHP heterodimers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16282330 2006 Regulation of 3-hydroxy-3-methylglutaryl coenzyme A reductase promoter by nuclear receptors liver receptor homologue-1 and small heterodimer partner: a mechanism for differential regulation of cholesterol synthesis and uptake.
16123152 2006 The human Na+-taurocholate cotransporting polypeptide gene is activated by glucocorticoid receptor and peroxisome proliferator-activated receptor-gamma coactivator-1alpha, and suppressed by bile acids via a small heterodimer partner-dependent mechanism.
15973435 2005 Regulation of hepatic metabolic pathways by the orphan nuclear receptor SHP.
15723037 2005 Modulation of human nuclear receptor LRH-1 activity by phospholipids and SHP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459958 2004 Mutation analysis of NR0B2 among 1545 Danish men identifies a novel c.278G>A (p.G93D) variant with reduced functional activity.
15358835 2004 Orphan nuclear receptor small heterodimer partner represses hepatocyte nuclear factor 3/Foxa transactivation via inhibition of its DNA binding.
15317749 2004 Reduced hepatic expression of farnesoid X receptor in hereditary cholestasis associated to mutation in ATP8B1.
15314177 2004 Role of an mSin3A-Swi/Snf chromatin remodeling complex in the feedback repression of bile acid biosynthesis by SHP.
15292277 2004 The orphan nuclear receptor SHP is involved in monocytic differentiation, and its expression is increased by c-Jun.
15269224 2004 Regulation of SHP-1 tyrosine phosphatase in human platelets by serine phosphorylation at its C terminus.
15202934 2004 The nuclear bile acid receptor FXR is activated by PGC-1alpha in a ligand-dependent manner.
15123650 2004 Differential regulation of human and mouse orphan nuclear receptor small heterodimer partner promoter by sterol regulatory element binding protein-1.
14762685 2004 Epigenetic dysregulation of the Jak/STAT pathway by frequent aberrant methylation of SHP1 but not SOCS1 in acute leukaemias.
14752053 2004 Orphan nuclear receptor small heterodimer partner, a novel corepressor for a basic helix-loop-helix transcription factor BETA2/neuroD.
14672953 2004 Inhibitory effect of the small heterodimer partner on hepatocyte nuclear factor-4 mediates bile acid-induced repression of the human angiotensinogen gene.
14627819 2003 Synergistic activation of the human orphan nuclear receptor SHP gene promoter by basic helix-loop-helix protein E2A and orphan nuclear receptor SF-1.
14593077 2004 Inhibition of aromatase transcription via promoter II by short heterodimer partner in human preadipocytes.
12842887 2003 Estrogen receptor alpha regulates expression of the orphan receptor small heterodimer partner.
12716767 2003 Contribution of variants in the small heterodimer partner gene to birthweight, adiposity, and insulin levels: mutational analysis and association studies in multiple populations.
12716764 2003 Genetic variation in the small heterodimer partner gene and young-onset type 2 diabetes, obesity, and birth weight in U.K. subjects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324453 2002 Glucocorticoid signaling is perturbed by the atypical orphan receptor and corepressor SHP.
12198243 2002 The small heterodimer partner interacts with the liver X receptor alpha and represses its transcriptional activity.
12181644 2002 Identification of polymorphisms in the human SHP1 gene.
11890664 2002 Nuclear translocation of SHP and visualization of interaction with HNF-4alpha in living cells.
11861507 2002 The agonist activity of tamoxifen is inhibited by the short heterodimer partner orphan nuclear receptor in human endometrial cancer cells.
11735420 2001 Characterization of the interaction between androgen receptor and a new transcriptional inhibitor, SHP.
11705994 2002 Differential regulation of the orphan nuclear receptor small heterodimer partner (SHP) gene promoter by orphan nuclear receptor ERR isoforms.
11696534 2002 Small heterodimer partner, an orphan nuclear receptor, augments peroxisome proliferator-activated receptor gamma transactivation.
11668176 2002 Dual mechanisms for repression of the monomeric orphan receptor liver receptor homologous protein-1 by the orphan small heterodimer partner.
11136233 2001 Mutations in the small heterodimer partner gene are associated with mild obesity in Japanese subjects.
11030331 2000 Molecular basis for feedback regulation of bile acid synthesis by nuclear receptors.
10648597 2000 The orphan nuclear receptor SHP utilizes conserved LXXLL-related motifs for interactions with ligand-activated estrogen receptors.
10594021 2000 The orphan nuclear receptor SHP inhibits hepatocyte nuclear factor 4 and retinoid X receptor transactivation: two mechanisms for repression.
9773978 1998 Inhibition of estrogen receptor action by the orphan receptor SHP (short heterodimer partner).
9603951 1998 Structure and expression of the orphan nuclear receptor SHP gene.
8650544 1996 An orphan nuclear hormone receptor that lacks a DNA binding domain and heterodimerizes with other receptors.