Property Summary

Ligand Count 1
NCBI Gene PubMed Count 114
PubMed Score 598.26
PubTator Score 250.13

Knowledge Summary

Patent (41,489)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.900 3.1e-32
pancreatic cancer -1.200 1.5e-03

Protein-protein Interaction (2)

Gene RIF (93)

AA Sequence

MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREALDVLAKTVAFL      1 - 70
RNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQ     71 - 140
PSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLCEVLEPWCPAA    141 - 210
QGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLLGDMLLLR                           211 - 257
//

Text Mined References (114)

PMID Year Title