Property Summary

Ligand Count 57
NCBI Gene PubMed Count 507
PubMed Score 1326.41
PubTator Score 1307.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (554)

AA Sequence

MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPA      1 - 70
ESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRS     71 - 140
KKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKK    141 - 210
RLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK          211 - 274
//

Text Mined References (515)

PMID Year Title