Property Summary

NCBI Gene PubMed Count 35
PubMed Score 37.86
PubTator Score 89.11

Knowledge Summary

Patent (5,876)

TINX Plot

  Disease (3)

Disease Target Count
Obesity 616
Disease Target Count P-value
psoriasis 6685 6.3e-38
invasive ductal carcinoma 2950 5.3e-03
astrocytic glioma 2241 1.1e-02
ductal carcinoma in situ 1745 2.3e-02
oligodendroglioma 2849 4.3e-02
Disease Target Count Z-score Confidence
Spindle cell hemangioma 16 3.068 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 1.1e-02
oligodendroglioma -1.300 4.3e-02
ductal carcinoma in situ -1.500 2.3e-02
invasive ductal carcinoma -1.900 5.3e-03
psoriasis -1.600 6.3e-38

Gene RIF (26)

PMID Text
25132261 NPY5R is an inducible pro-survival factor that is responsible for chemoresistance in neuroblastoma cells.
23932937 these data highlight a novel mechanism by which NPY may promote breast cancer progression, and further implicate a pathological role of the NPY Y5R.
23900445 Variations in genes AGRP, CPE, GHRL, GLP1R, HTR2A, NPY1R, NPY5R, SOCS3 and STAT3 showed modest associations with BMI in European Americans.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20332211 Together, our results suggest that Y5R plays an important role in cancer cell growth and migration and could be a novel therapeutic target for breast cancer.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19759915 NPY1R and NPY5R have roles in nutrient-specific food intake in Europeans
19759915 Observational study of gene-disease association. (HuGE Navigator)
19593212 Observational study of gene-disease association. (HuGE Navigator)
19481128 Results suggest that rabbit and human Y1, Y2 and Y5 receptor subtypes are well conserved, whereas Y4 receptors are less well conserved.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18828811 Sequence variations in neuropeptide Y receptor genes (NPY5R and NPY2R) are associated with alcohol dependence, cocaine dependence, and comorbid alcohol and cocaine dependence.
18828811 Observational study of gene-disease association. (HuGE Navigator)
17948870 Observational study of gene-disease association. (HuGE Navigator)
17426313 Observational study of gene-disease association. (HuGE Navigator)
17426313 single nucleotide polymorphisms in the NPY5R gene may have a role in dyslipidemia (elevated triglyceride concentrations and reduced high-density lipoprotein levels) in Mexican Americans
17325259 Observational study of gene-disease association. (HuGE Navigator)
16891622 Neuropeptide-Y induced endothelial cell migration was mimicked by agonists and fully blocked by antagonists for any specific NPY receptor (NPY5R).
15601626 Functional studies of new ligands for this receptor.
15302312 Observational study of gene-disease association. (HuGE Navigator)
12398768 The authenticity of this transcript was confirmed by isolating part of its 5'UTR and analysing its tissue distribution,, we have shown that the two AUG triplets contained in the 5' untranslated region of Y5(L) mRNA did not affect receptor expression
12220433 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKR      1 - 70
NQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRY     71 - 140
HMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIA    141 - 210
FTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYS    211 - 280
FIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHEL    281 - 350
RVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL    351 - 420
NPILYGFLNNGIKADLVSLIHCLHM                                                 421 - 445
//

Text Mined References (37)

PMID Year Title
25132261 2015 Neuropeptide Y receptor Y5 as an inducible pro-survival factor in neuroblastoma: implications for tumor chemoresistance.
24681953 2015 Persistent STAT5 activation in myeloid neoplasms recruits p53 into gene regulation.
23932937 2013 Neuropeptide Y Y5-receptor activation on breast cancer cells acts as a paracrine system that stimulates VEGF expression and secretion to promote angiogenesis.
23900445 2014 Genetic association analysis of 30 genes related to obesity in a European American population.
22029806 2011 Expression of Neuropeptide Y, Substance P, and their receptors in the right atrium of diabetic patients.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20332211 2010 Neuropeptide Y Y5 receptor promotes cell growth through extracellular signal-regulated kinase signaling and cyclic AMP inhibition in a human breast cancer cell line.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19759915 2009 Variants in neuropeptide Y receptor 1 and 5 are associated with nutrient-specific food intake and are under recent selection in Europeans.
19593212 2009 Novel genetic variants contributing to left ventricular hypertrophy: the HyperGEN study.
19481128 2009 Cloning and characterization of rabbit neuropeptide Y receptor subtypes.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18828811 2008 Neuropeptide Y receptor genes are associated with alcohol dependence, alcohol withdrawal phenotypes, and cocaine dependence.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
17948870 2008 Chromosome 4q31-34 panic disorder risk locus: association of neuropeptide Y Y5 receptor variants.
17426313 2007 Association of neuropeptide Y receptor Y5 polymorphisms with dyslipidemia in Mexican Americans.
17325259 2007 Association studies of BMI and type 2 diabetes in the neuropeptide Y pathway: a possible role for NPY2R as a candidate gene for type 2 diabetes in men.
16891622 2006 Neuropeptide Y induces migration, proliferation, and tube formation of endothelial cells bimodally via Y1, Y2, and Y5 receptors.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15601626 2005 Functional characterization of human neuropeptide Y receptor subtype five specific antagonists using a luciferase reporter gene assay.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302312 2004 Genotype analysis of the neuropeptide Y (NPY) Y1 and NPY Y5 receptor genes in gonadotropin-releasing hormone-dependent precocious gonadarche.
12665544 2003 The use of bioluminescence resonance energy transfer 2 to study neuropeptide Y receptor agonist-induced beta-arrestin 2 interaction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12398768 2003 Molecular identification of the long isoform of the human neuropeptide Y Y5 receptor and pharmacological comparison with the short Y5 receptor isoform.
12220433 2002 Novel neuropeptide Y1 and Y5 receptor gene variants: associations with serum triglyceride and high-density lipoprotein cholesterol levels.
12007534 2002 Neuropeptide Y receptors as targets for anti-obesity drug development: perspective and current status.
10575027 1999 Conservation of expression of neuropeptide Y5 receptor between human and rat hypothalamus and limbic regions suggests an integral role in central neuroendocrine control.
9417917 1997 Neuropeptide Y receptor genes mapped in human and mouse: receptors with high affinity for pancreatic polypeptide are not clustered with receptors specific for neuropeptide Y and peptide YY.
9169127 1997 Overlapping gene structure of the human neuropeptide Y receptor subtypes Y1 and Y5 suggests coordinate transcriptional regulation.
8824284 1996 Identification of a novel hypothalamic neuropeptide Y receptor associated with feeding behavior.
8700207 1996 A receptor subtype involved in neuropeptide-Y-induced food intake.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.