Property Summary

Ligand Count 304
NCBI Gene PubMed Count 72
PubMed Score 180.29
PubTator Score 28.12

Knowledge Summary

Patent (6,104)


  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis -3.617 4.7e-02
adrenocortical carcinoma -3.411 1.2e-07
adult high grade glioma -2.800 4.6e-03
astrocytic glioma -3.000 5.4e-04
Astrocytoma, Pilocytic -2.600 2.6e-04
atypical teratoid / rhabdoid tumor -3.000 9.9e-04
Breast cancer -1.700 4.0e-02
cystic fibrosis and chronic rhinosinusit... 1.994 5.9e-03
ductal carcinoma in situ -2.700 3.5e-02
ependymoma -2.400 2.2e-02
glioblastoma -2.200 5.8e-04
intraductal papillary-mucinous adenoma (... -2.200 1.9e-04
intraductal papillary-mucinous carcinoma... -1.300 1.8e-02
invasive ductal carcinoma -3.500 5.3e-03
lung cancer 1.600 2.4e-03
malignant mesothelioma 1.200 8.4e-04
medulloblastoma -2.200 3.4e-03
medulloblastoma, large-cell -3.600 1.7e-03
oligodendroglioma -2.200 3.0e-02
ovarian cancer -6.400 4.9e-30
pancreatic cancer -1.300 7.7e-03
primitive neuroectodermal tumor -2.200 1.6e-02
psoriasis -1.300 8.2e-05

 CSPA Cell Line (2)

Protein-protein Interaction (3)

Gene RIF (47)

AA Sequence

AMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI                                        351 - 384

Text Mined References (73)

PMID Year Title