Property Summary

NCBI Gene PubMed Count 70
PubMed Score 177.90
PubTator Score 28.12

Knowledge Summary

Patent (6,104)

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 1.200 8.4e-04
astrocytic glioma -3.000 5.4e-04
ependymoma -2.400 2.2e-02
oligodendroglioma -2.600 1.3e-23
psoriasis -1.600 4.5e-06
glioblastoma -3.400 3.2e-04
atypical teratoid / rhabdoid tumor -3.000 9.9e-04
medulloblastoma -2.200 3.4e-03
medulloblastoma, large-cell -3.600 1.7e-03
primitive neuroectodermal tumor -2.200 1.6e-02
adrenocortical carcinoma -3.411 1.2e-07
intraductal papillary-mucinous adenoma (... -2.200 1.9e-04
intraductal papillary-mucinous carcinoma... -1.300 1.8e-02
lung cancer 1.600 2.4e-03
active ulcerative colitis -3.617 4.7e-02
pancreatic cancer -1.300 7.7e-03
adult high grade glioma -2.800 4.6e-03
pilocytic astrocytoma -2.600 2.8e-04
Breast cancer -1.700 4.0e-02
ductal carcinoma in situ -2.700 3.5e-02
invasive ductal carcinoma -3.500 5.3e-03
ovarian cancer -6.400 4.9e-30
cystic fibrosis and chronic rhinosinusit... 1.994 5.9e-03

 CSPA Cell Line (2)

MLP Assay (29)

AID Type Active / Inconclusive / Inactive Description
1040 screening 1990 / 0 / 194265 Primary cell-based high-throughput screening assay for antagonists of NPY-Y1
1254 screening 252 / 0 / 943 Cell-based high-throughput confirmation assay for antagonists of neuropeptide Y receptor Y1 (NPY-Y1)
1256 screening 135 / 0 / 572 Counterscreen assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2): Cell-based high throughput assay to measure NPY-Y1 antagonism.
1277 confirmatory 14 / 0 / 49 Dose response cell-based screening assay for antagonists of neuropeptide Y receptor Y1 (NPY-Y1)
1279 confirmatory 74 / 0 / 45 Dose response counterscreen for neuropeptide Y receptor Y2 (NPY-Y2): Cell-based high throughput assay to measure NPY-Y1 antagonism
1304 screening 800 / 0 / 217317 Primary cell-based high-throughput screening assay for potentiators or agonists of NPY-Y1
1546 screening 69 / 0 / 212 Confirmation cell-based high-throughput screening assay for potentiators or agonists of NPY-Y1
1651 screening 84 / 0 / 369 Fluorescence counterscreen assay for potentiators or agonists of NPY-Y2: Cell-based high-throughput screening assay to identify potentiators or agonists of NPY-Y1.
1697 screening 141 / 0 / 140 Fluorescence-based counterscreen assay for potentiators of NPY-Y1: cell-based high-throughput screening assay to identify agonists of NPY-Y1
1702 screening 168 / 0 / 285 Fluorescence-based counterscreen assay for potentiators of NPY-Y2: cell-based high-throughput screening assay to identify agonists of NPY-Y1.
More...

Gene RIF (45)

PMID Text
25884646 Report design of argininamide-type NPY1R antagonists.
25817573 MAPK activation by NPY Y1 receptors is an internalization-independent pathway and that this receptor can transactivate the IGFR receptor.
24779394 NPY and its Y receptor are possible mediators of both vasoconstriction and pulmonary vascular remodelling in pulmonary hypertension
23838112 Y1R expression in visceral adipose tissue might be an indicator of increased risk of metabolic syndrome.
22487268 The influence of beta-arrestin adaptors and endocytosis mechanisms on plasma membrane diffusion and particle brightness of GFP-tagged neuropeptide Y (NPY) receptors, was investigated.
22309839 For the first time we report a significant association between nicotine dependence and DRD5, NPY1R MAP3K4 single nucleotide polymorphism.
21971867 Npy1 receptor transgene overexpression is associated with modest anxiolytic-like effect on mice in the open field and elevated plus maze tests.
21295110 neuropeptide Y1 and Y2 receptors were expressed in 33 percent of testicular tumors and Y1 on intratumoral blood vessels in 50 percent of testicular tumors
20837140 A C-terminal tyrosine-based motif is critical for the constitutive internalization of Y(1) receptors lacking the last 32 C-terminal amino acids.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20471432 results suggest that the receptor-ligand interactions have changed during evolution after Y1 and Y2 arose from a common ancestral receptor
20468064 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19759915 NPY1R and NPY5R have roles in nutrient-specific food intake in Europeans
19759915 Observational study of gene-disease association. (HuGE Navigator)
19712806 novel pathophysiological links between the NPY1R locus, autonomic activity, and blood pressure
19699258 Data suggest that neuropeptide Y modulates steroid production through Y1 receptors in human adrenal H295R cells.
19593212 Observational study of gene-disease association. (HuGE Navigator)
19566775 Genotypic distribution of the NPY1R gene showed a significant association with methamphetamine dependence and psychosis (P = 0.04), whereas the NPY gene had no significant association with them.
19506390 the studied LEP, NPY1R and GPR54 variants do not have a major influence upon pubertal timing in Caucasian women.
19506390 Observational study of gene-disease association. (HuGE Navigator)
19481128 Results suggest that rabbit and human Y1, Y2 and Y5 receptor subtypes are well conserved, whereas Y4 receptors are less well conserved.
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18953866 The increased expression of NPY Y1 receptor may be related to local blood flow reduction and structural changes of pelvic supporting tissue in patients with pelvic organ prolapse.
18828811 Observational study of gene-disease association. (HuGE Navigator)
18812316 ICL3 stabilizes the Y1 receptor in the inactive state and confers structural properties critical for regulating Y receptor activation and signal transduction
18698022 Ewing sarcoma family of tumors expressed the NPY receptor subtype Y1 on tumor cells in remarkably high incidence
17948870 Observational study of gene-disease association. (HuGE Navigator)
17325259 Observational study of gene-disease association. (HuGE Navigator)
17140570 data suggest that the K374T variant is a rare, nonfunctional polymorphism of the NPY-Y1R gene and that mutations of the highly conserved NPY-Y1R gene do not represent a frequent mechanism underlying human idiopathic central pubertal disorders.
16891622 Neuropeptide-Y induced endothelial cell migration was mimicked by agonists and fully blocked by antagonists for any specific NPY receptor (NPY1R).
16339211 Y1 receptor activation by neuropeptide Y regulates the growth of prostate cancer cells
15623622 High expression of neuropeptide Y receptor Y1 is associated with tumors of the human adrenal gland and extra-adrenal paraganglia
15597110 Observational study of gene-disease association. (HuGE Navigator)
15302312 Observational study of gene-disease association. (HuGE Navigator)
12220433 Observational study of gene-disease association. (HuGE Navigator)
12209475 a study of ligand-receptor interactions (review)
12203398 Expression of Y1 receptors characterize reactive and proliferating glial cells of diseased retina and may be involved in proliferation of injured glial cells causing regrowth of vitreoretinopathy membranes and consequent secondary retinal detachments.
12084524 human NPY Y1 and NPY Y2 receptors were detected in cerebral, meningeal, and coronary arteries using reverse transcriptase-polymerase chain reaction (RT-PCR); in addition, the trigeminal and superior cervical ganglia were positive for both receptors
11906964 Peptide YY and neuropeptide Y exert their effects through the NPY1 receptors in human colon mucosa.
11814622 the NPY Y(1) receptor induces the expression of CRE containing target genes through the CaM kinase-CREB pathway

AA Sequence

MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKE      1 - 70
MRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQ     71 - 140
LIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLS    141 - 210
YTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLT    211 - 280
IFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETI    281 - 350
AMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI                                        351 - 384
//

Text Mined References (71)

PMID Year Title
25884646 2015 Toward Labeled Argininamide-Type NPY Y1 Receptor Antagonists: Identification of a Favorable Propionylation Site in BIBO3304.
25817573 2015 Neuropeptide Y receptor mediates activation of ERK1/2 via transactivation of the IGF receptor.
24779394 2014 NPY/Y? receptor-mediated vasoconstrictory and proliferative effects in pulmonary hypertension.
23838112 2013 Expressions of neuropeptide Y and Y1 receptor in subcutaneous and visceral fat tissues in normal weight and obese humans and their correlations with clinical parameters and peripheral metabolic factors.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
22626516 2012 Knockdown of a G protein-coupled receptor through efficient peptide-mediated siRNA delivery.
22487268 2012 Fluorescence correlation spectroscopy, combined with bimolecular fluorescence complementation, reveals the effects of ?-arrestin complexes and endocytic targeting on the membrane mobility of neuropeptide Y receptors.
22309839 2012 Association study of 45 candidate genes in nicotine dependence in Han Chinese.
22072432 2011 Identification of novel GH-regulated genes in C2C12 cells.
22029806 2011 Expression of Neuropeptide Y, Substance P, and their receptors in the right atrium of diabetic patients.
21971867 2012 Neuropeptide Y Y1 receptor hippocampal overexpression via viral vectors is associated with modest anxiolytic-like and proconvulsant effects in mice.
21512575 2011 Dysbindin-1 and NRG-1 gene expression in immortalized lymphocytes from patients with schizophrenia.
21295110 2011 High expression of NPY receptors in the human testis.
20975297 2010 A dysregulation in CES1, APOE and other lipid metabolism-related genes is associated to cardiovascular risk factors linked to obesity.
20837140 2011 Contribution of a tyrosine-based motif to cellular trafficking of wild-type and truncated NPY Y(1) receptors.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20471432 2010 Mutagenesis of human neuropeptide Y/peptide YY receptor Y2 reveals additional differences to Y1 in interactions with highly conserved ligand positions.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20358617 2010 Characterization of an interstitial 4q32 deletion in a patient with mental retardation and a complex chromosome rearrangement.
20042335 2010 [Lys(DOTA)4]BVD15, a novel and potent neuropeptide Y analog designed for Y1 receptor-targeted breast tumor imaging.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19759915 2009 Variants in neuropeptide Y receptor 1 and 5 are associated with nutrient-specific food intake and are under recent selection in Europeans.
19712806 2009 Neuropeptide Y(1) Receptor NPY1R discovery of naturally occurring human genetic variants governing gene expression in cella as well as pleiotropic effects on autonomic activity and blood pressure in vivo.
19699258 2010 Neuropeptide Y modulates steroid production of human adrenal H295R cells through Y1 receptors.
19593212 2009 Novel genetic variants contributing to left ventricular hypertrophy: the HyperGEN study.
19566775 2009 Association between neuropeptide Y gene and its receptor Y1 gene and methamphetamine dependence.
19506390 2009 Three common variants of LEP, NPY1R and GPR54 show no association with age at menarche.
19481128 2009 Cloning and characterization of rabbit neuropeptide Y receptor subtypes.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18953866 2008 [Expression of neuropeptide Y and its receptors in the cardinal ligaments and uterosacral ligaments in patients with pelvic organ prolapse].
18828811 2008 Neuropeptide Y receptor genes are associated with alcohol dependence, alcohol withdrawal phenotypes, and cocaine dependence.
18812316 2008 The third intracellular loop stabilizes the inactive state of the neuropeptide Y1 receptor.
18698022 2008 High expression of neuropeptide Y1 receptors in ewing sarcoma tumors.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
17948870 2008 Chromosome 4q31-34 panic disorder risk locus: association of neuropeptide Y Y5 receptor variants.
17325259 2007 Association studies of BMI and type 2 diabetes in the neuropeptide Y pathway: a possible role for NPY2R as a candidate gene for type 2 diabetes in men.
17140570 2007 Molecular analysis of the neuropeptide Y1 receptor gene in human idiopathic gonadotropin-dependent precocious puberty and isolated hypogonadotropic hypogonadism.
16891622 2006 Neuropeptide Y induces migration, proliferation, and tube formation of endothelial cells bimodally via Y1, Y2, and Y5 receptors.
16532386 2006 Genome scan for loci predisposing to anxiety disorders using a novel multivariate approach: strong evidence for a chromosome 4 risk locus.
16399808 2006 Large-scale expression study of human mesial temporal lobe epilepsy: evidence for dysregulation of the neurotransmission and complement systems in the entorhinal cortex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339211 2006 Activation of the Y1 receptor by neuropeptide Y regulates the growth of prostate cancer cells.
15623622 2004 High expression of neuropeptide y receptors in tumors of the human adrenal gland and extra-adrenal paraganglia.
15597110 2005 Melanocortin-4 receptor gene and physical activity in the Québec Family Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302312 2004 Genotype analysis of the neuropeptide Y (NPY) Y1 and NPY Y5 receptor genes in gonadotropin-releasing hormone-dependent precocious gonadarche.
15231747 2004 A protein interaction framework for human mRNA degradation.
15090072 2004 A case of autism with an interstitial deletion on 4q leading to hemizygosity for genes encoding for glutamine and glycine neurotransmitter receptor sub-units (AMPA 2, GLRA3, GLRB) and neuropeptide receptors NPY1R, NPY5R.
14741323 2004 Microarray screening of lymphocyte gene expression differences in a multiplex schizophrenia pedigree.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665544 2003 The use of bioluminescence resonance energy transfer 2 to study neuropeptide Y receptor agonist-induced beta-arrestin 2 interaction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220433 2002 Novel neuropeptide Y1 and Y5 receptor gene variants: associations with serum triglyceride and high-density lipoprotein cholesterol levels.
12209475 2001 Biophysical methods to study ligand-receptor interactions of neuropeptide Y.
12203398 2002 Y1 receptor of neuropeptide Y as a glial marker in proliferative vitreoretinopathy and diseased human retina.
12084524 2002 Neuropeptide Y Y1 and neuropeptide Y Y2 receptors in human cardiovascular tissues.
12007534 2002 Neuropeptide Y receptors as targets for anti-obesity drug development: perspective and current status.
11906964 2002 Neuropeptide Y, Y1, Y2 and Y4 receptors mediate Y agonist responses in isolated human colon mucosa.
11814622 2002 Predominant role by CaM kinase in NPY Y(1) receptor signaling: involvement of CREB [corrected].
11741903 2002 Rapid internalization and recycling of the human neuropeptide Y Y(1) receptor.
9169155 1997 Neuropeptide Y receptor genes on human chromosome 4q31-q32 map to conserved linkage groups on mouse chromosomes 3 and 8.
9001438 1995 Neuropeptide Y receptor subtypes.
8095935 1993 Genomic organization, localization, and allelic differences in the gene for the human neuropeptide Y Y1 receptor.
7559383 1995 Cloning and functional expression of a cDNA encoding a human type 2 neuropeptide Y receptor.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
1321422 1992 Cloned human neuropeptide Y receptor couples to two different second messenger systems.
1317848 1992 Cloning and functional expression of a human neuropeptide Y/peptide YY receptor of the Y1 type.