Property Summary

NCBI Gene PubMed Count 287
PubMed Score 7433.26
PubTator Score 1859.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 1.5
Periodontal disease 40 0.0 2.1

Expression

  Differential Expression (12)

Disease log2 FC p
Alzheimer's disease -1.800 2.7e-02
astrocytic glioma -1.800 5.3e-03
Astrocytoma, Pilocytic -3.100 3.9e-06
atypical teratoid / rhabdoid tumor -1.600 2.4e-02
ependymoma -2.100 1.3e-04
glioblastoma -1.800 2.7e-03
group 3 medulloblastoma -3.200 1.0e-02
medulloblastoma, large-cell -2.800 7.2e-03
oligodendroglioma -1.500 3.2e-02
pediatric high grade glioma -2.200 3.7e-03
Pick disease -1.800 9.2e-04
psoriasis -1.300 3.0e-03

Gene RIF (277)

AA Sequence

MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP      1 - 70
ETLISDLLMRESTENVPRTRLEDPAMW                                                71 - 97
//

Text Mined References (289)

PMID Year Title