Property Summary

NCBI Gene PubMed Count 277
PubMed Score 7285.29
PubTator Score 1859.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 1.0
Periodontal disease 37 0.0 2.0

Expression

  Differential Expression (12)

Disease log2 FC p
Alzheimer's disease -1.800 2.7e-02
astrocytoma -3.100 8.6e-04
oligodendroglioma -2.000 1.2e-16
glioblastoma -3.000 1.2e-03
posterior fossa group A ependymoma -2.500 3.8e-06
medulloblastoma -3.200 7.2e-07
atypical teratoid / rhabdoid tumor -1.600 2.4e-02
medulloblastoma, large-cell -2.800 7.2e-03
pediatric high grade glioma -2.200 3.7e-03
pilocytic astrocytoma -3.100 5.1e-06
Pick disease -1.800 9.2e-04
psoriasis -1.300 3.0e-03

Gene RIF (267)

PMID Text
26683132 NPY plays important roles in the pathogenesis and pathophysiology of pituitary adenomas, as shown in this clinical study.
26621486 NPY is efficiently cleaved by FAP indicating a potential function for FAP in neuropeptide regulation within liver and cancer biology.
26291814 NPY levels were higher in both obese and non-obese PCOS patients compared to healthy controls.
26240981 This study suggests that NPY rs16147 T and rs16139 C minor alleles are associated with increased risk, whereas the minor allele T of the rs5574 is associated with a reduced risk of obesity.
26220979 Authors observed that NPY levels were decreased in two Machado-Joseph disease patients' cerebella.
26156739 Data suggest that an SNP in NPY (rs16147) is associated with change in abdominal adiposity in subjects with central obesity in response to dietary interventions (low/high fat); T allele carriers on high-fat diet regained abdominal fat.
26111352 Suggest IL-4 as marker of allergic airway inflammation in asthma, and roles for adiponectin and neuropeptide Y in neurohormonal signaling.
26021463 The mean neuropeptide-Y level was 62.29 +/- 13.89 pg/mL in the breath-holding spells group and 58.24 +/- 12.30 pg/mL in the control group.
26002416 Immunohistochemical distribution of this peptide in the epidermal skin (from abdomen, breast and face) of healthy women was analysed.
25924821 The C-terminal alpha-helix of Neuropeptide Y, which is formed in a membrane environment in the absence of the receptor, is unwound starting at T(32) to provide optimal contacts in a binding pocket within the transmembrane bundle of the NPY-Y2 receptor.
25920420 Data suggest that nutritional status and up-regulation of NPY in cerebrospinal fluid are related to disease progression in adults with chronic kidney disease (CKD); up-regulation of serum NPY levels may predict risk of cardiovascular events in CKD.
25871004 polymorphisms in the gene may be useful in identifying women at risk for osteoporosis.
25798605 in AN patients, the NPY system is not up-regulated by chronic undernutrition suggesting that this may play a role in the inability of anorectic women to adapt food intake to their energy demand.
25714031 neuropeptide Y has a role in Ewing sarcoma bone invasion
25453484 The data are in line with the hypothesis that NPY signaling is altered in affective disorders and states of emotional dysregulation.
25427865 This study suggests that the rs16147 polymorphism in the NPY gene may not be a potential contributor to the risk of CAD in an Iranian population.
25387699 Systemic NPY levels are elevated in patients with Ewing sarcoma, and these high levels are associated with unfavorable disease features.
25258030 minor autoantigen in children with newly diagnosed type 1 diabetes
25256105 study is the first to observe a sexually dimorphic role of alleles at NPY in humans and support previous genome-wide findings of a role of NPY in severe PD.
25221996 Polymorphisms within NPY are associated with vitiligo susceptibility.
25081719 NPY may be a possible contributor to metabolic syndrome and associated cancer for the Han ethnic group.
25026432 A putative mechanism based on NPY-induced inhibition of voltage-dependent Ca(2+) influx in pre- and post-synaptic neurons is proposed.
24965867 Distribution of peptidergic populations in the human dentate gyrus (somatostatin [SOM-28, SOM-12] and neuropeptide Y [NPY]) during postnatal development.
24897239 The rs16147 polymorphism may be associated with presence of metabolic syndrome (MetS) among subjects with documented coronary artery disease (CAD). Carriage of NPY A allele in patients with CAD is associated with a higher prevalence of MetS.
24858338 NPY expression is increased during atherogenesis and in particular in unstable plaques
24779394 NPY and its Y receptor are possible mediators of both vasoconstriction and pulmonary vascular remodelling in pulmonary hypertension
24757681 In a series of human fetuses, neuropeptide Y-containing nerve fibers was present and could be detected as early as in the pineal of four- to five-month-old fetuses.
24709369 relationship existed between serum NPY and depressive disorders, posttraumatic stress disorder, and resilience.
24699455 During an immune/inflammatory response NPY may exert proinflammatory effects.
24289328 Promoter methylation of WIF1, PENK and NPY is associated with colorectal adenocarcinoma (CRC) diagnosis and can be used to CRC from other cancers.
24213859 BIBP-3226 was used to antagonize Y(1)-receptors, NPY to test the efficacy of the antagonism.
24184719 In this review, we will focus on the roles of NPY in the retina, specifically proliferation, neuromodulation and neuroprotection. [review]
24121255 Data indicate modest association of the age at onset (AO) with two neuropeptide Y (NPY) promoter variations and a highly significant association with NPY receptor NPY2R promoter single nucleotide polymorphism (SNP rs2234759).
24077326 NPY levels were found to be significantly higher in coronary stenosis patients with well-developed coronary collaterals compared with patients with poorly developed collaterals.
24012636 Noradrenaline and NPY are involved in the initial, rapid rise in skin blood flow at the onset of local skin warming. Their vasodilator actions in response to local skin warming appears to be manifested through eNOS.
23994577 Elevation of human NPY mRNA and peptide levels are induced by therapeutic concentrations of valproic acid following chronic treatment.
23864142 The results of this study indicate a connection between elevated concentration of NPY and VIP and decreased DPP IV/CD26 activity and concentration, suggesting a potential role of these molecules in the immunomodulation of rheumatoid arthritis.
23838112 Serum NPY levels are higher in obese than normal weight groups.
23831408 Leukocyte methylation levels reflect a putative epigenetic regulation of NPY and POMC, which might be implicated in weight regain in obese men.
23652383 The study concluded that SNP rs16147 in the NP-Y promoter gene is associated with serum leptin levels and body fat distribution in women.
23624317 Neuropeptide Y rs16147 and rs16131 single nucleotide polymorphisms are associated with obesity.
23599389 A neostriatal defect of the neuropeptide Y system is found in patients with X-linked dystonia-parkinsonism.
23482625 Study demonstrated an interaction of NPY genotype and childhood emotional maltreatment on amygdala and posterior cingulate cortex activation during processing of emotional faces, in addition to a faster behavioral response
23468908 The gene polymorphism loci rs16139 was closely related to MDD in Chinese Han population.
23457218 Compared to NPY-null platelets, collagen-activated NPY-rich platelets are more mitogenic (~2-fold vs. ~1.6-fold increase) for microvascular endothelial cells.
23407263 study of schizophrenic patients, NPY gene and suicidality did not support any major invalvement of the NPY gene
23403409 Plasma NPY levels correlate with indices of reperfusion and coronary microvascular resistance in myocardial infarction after PCI treatment.
23390522 Robust population-independent transcriptional changes in prostate cancer include ERG rearrangements inducing metabolic changes in cancer cells by activating major metabolic signaling molecules like neuropeptide Y.
23277265 Report association of NPY SNPs with psychotic-induced weight gain.
23122776 Overweight together with the NPY-399T allele without NPY-Pro7 allele was associated with increased risk for asthma
23116540 In this review, we highlight recent evidences concerning paracrine/autocrine actions of NPY involved in neuroprotection, neurogenesis and neuroinflammation--{REVIEW}
23110814 We summarize here current knowledge of the neuronal interactions between NPY and the different types of feeding-regulating peptide-containing neurons in the hypothalamus--{REVIEW}
23107365 NPY neuron in the arcuate nucleus is an essential feeding center to induce food intake in response to peripheral metabolic state--{REVIEW}
23083763 the recent findings provide clear evidence demonstrating critical roles for dorsomedial hypothalamus NPY in energy balance controL--{REVIEW}
23074243 Data suggest that effects of neuropeptide Y (NPY) on hepatic VLDL-triglyceride secretion (i.e., occur via NPY receptor 2) can be dissociated from effects on feeding behavior (i.e., occur via NPY receptor 1); studies used selective agonists.
23021333 common genetic variation at the NPY locus, especially in proximal promoter nabla-880Delta, disrupts glucocorticoid signaling to influence NPY transcription and secretion, raising systemic vascular resistance and early heritable responses to environmental stress
22985695 These data suggest a direct relationship between cerebrospinal fluid NPY-immunoreactivity concentration and measures of impulsive aggression in human subjects
22979996 These findings underscore the important role of the NPY-Y receptor system at several levels of the gut-brain axis in which NPY, peptide yy and pancreatic polypeptide operate both as neural and endocrine messengers--{REVIEW}
22966009 Data suggest that neuropeptide Y (NPY) rs16147 may modulate the association between dietary fat intake and changes in blood pressure (BP), and the C allele exerts a beneficial effect on lowering BP in response to low-fat diet.
22941950 study is the first longitudinal study to report an association between neuropeptide Y promotor polymorphism rs16147 and body mass index during childhood and adolescence
22849656 Results showed that NT, NPY, and PGP 9.5 neurofibers are almost equally present in pseudocapsule of uterine fibroids as in normal myometrium of a no pregnant uterus. As all of these neuropeptides are present in the uterine muscle and can affect muscle contractility, uterine peristalsis and muscular healing.
22808091 The expression of NPY and VGF was increased in the arcuate nucleus, but decreased in the nucleus of the Tractus Solitarius in the brains of type-II diabetic patients.
22632858 Deregulation of NPY/NPY receptor signaling can lead to either development of obesity or anorexia nervosa. [REVIEW]
22584873 results provide evidence for an involvement of the functionally relevant SNP rs16147 in the pathophysiology of tobacco dependence.
22492775 AgRP and NPY are correlated with body weight changes, rather than the presence of type 2 diabetes, whereas changes in alphaMSH immunoreactivity are related to the presence of type 2 diabetes, indicating separate hypothalamic mechanisms.
22393040 Findings indicate the unique function of cathepsin V for producing enkephalin and neuropeptide Y (NPY) neuropeptides required for neurotransmission in health and neurological diseases.
22328461 This study provides further support for involvement of mainly GAD1, but also NPY in determining predisposition to anxiety disorders.
22308535 the association between NPY Leu7Pro polymorphism and features of MetS in Iranian patients with coronary artery disease was determined.
22289186 The Leu7Pro polymorphism was associated with coronary artery disease in an Iranian population.
22143932 as the symptoms of POP intensify, the expression of NPY in anterior vaginal mucosa decreases progressively
21937627 NPY gene variants were significantly associated with weight changes from young adulthood to middle age and with risk of obesity.
21917383 findings are the first to document chronic drug abuse influences on NPY diplotype expression where NPY diplotype modulation of stress-related plasma NPY, heart rate and anxiety responses was absent in the substance abuse sample.
21898706 Patients with depression have higher levels of resiliency neuropeptide NPY in cerebrospinal fluid compared to normal subjects.
21849543 The M-current plays a pivotal role in the modulation of NPY neuronal excitability and may be an important cellular target for neurotransmitter and hormonal signals in the control of energy homeostasis in both males and females.
21796371 Differences in basal and stress-induced responses of NPY and BDNF were not supported between control and abstinent alcohol-dependent subjects.
21746772 Report association of inflammatory blood cell activation with vascular parameters in type 2 diabetes to elucidate mechanisms of accelerated atherosclerosis observed in subjects with the Leucine 7 to Proline 7 polymorphism in the neuropeptide Y.
21640760 somatostatin inhibits the neuropeptide Y response to hypoglycemia
21626172 NPY plays a role in the pathophysiology of vasospasm when released excessively into the plasma and cerebrospinal fluid following subarachnoid hemorrhage.
21468772 Neuropeptide Y and its receptors are associated with atherosclerotic lesion burden and vulnerability.
21426768 One year after sigmoid colon vaginoplasty, NPY expression was significantly lower in the neovagina than in the intact sigmoid colon, but was not upregulated 3 years postoperatively.
21396710 The presence of direct, catecholaminergic-NPY-IR synapses may explain increased NPY release during stress, and support its role in the responses that are directed to maintain homeostasis during stressful conditions.
21346312 NPY increases survival of cultured neuroblastoma cells and counteracts the toxic effect of amyloidbeta while restoring the neurotrophin levels in these cells.
21303710 The 1258 G>A polymorphism in the NPY is associated with higher alcohol consumption in the Mediterranean population.
21273004 Evidence of a gene-environment interaction between rs16147 and early adversity significantly affecting HPA axis responses to acute psychosocial stress.
21190576 Plasma NPY is elevated compared to healthy controls and to a fatigued comparison group, patients with Gulf War illness.
21145602 NPY may contribute to myocardial contractile dysfunction in stress cardiomyopathy
21047193 SNP Leu7Pro not associated with eating disorders
21047193 Observational study of gene-disease association. (HuGE Navigator)
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20945961 Fasting NPY were increased in both anorexia and bulimia nervosa patients compared to the controls
20832114 Data suggest a potential involvement of circulating neuropeptide Y in diabetes mellitus type 2 pathology.
20823688 Even though the expression of NPY, omentin and visfatin was comparable between obese individuals and controls, we have to consider differences in the total production rate of adipose tissue-derived factors
20734064 Observational study of gene-disease association. (HuGE Navigator)
20691708 Diabetes patients with the Pro7 NPY allele display increased levels of inflammatory molecules and NPY in blood, preceding vascular wall thickening and impaired endothelial dilatation, especially in male patients.
20691708 Observational study of gene-disease association. (HuGE Navigator)
20676138 Data show that both NPY and Y2Rs are commonly expressed in neuroblastoma cell lines and tissues.
20675276 Data describe neurons and nerve fibers of intestinal plexuses containing vasoactive intestinal peptide, pituitary adenylate cyclase-activating polypeptide and neuropeptide Y in pathologically changed parts of the large intestine in intestinal cancer.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20648632 These results show the importance of rs16147:T>C for regulation of NPY gene expression and brain function.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20543711 Observational study of gene-disease association. (HuGE Navigator)
20531438 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20459474 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20435026 Observational study of gene-disease association. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20308990 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20180986 Observational study of gene-disease association. (HuGE Navigator)
20173430 Observational study of gene-disease association. (HuGE Navigator)
20164781 Only the patients with nonalcoholic fatty liver presented a positive correlation between the saturated fatty acids intake and the orexigenic neuropeptides NPY and agouti related protein, and carbohydrate with NPY
20138117 Metabolic signals are integrated at the levels of first-order neurons equipped with the proper receptors, ant that these neurons send their signals towards hypothalamic GnRH neurons which constitute the integrative element of this network.
20037921 NPY moderates the relation between hurricane exposure and generalized anxiety disorder in an epidemiologic sample of hurrican exposed adults.
20033074 Hypertension is influenced by the NPY T1128C polymorphism.
20033074 Observational study of gene-disease association. (HuGE Navigator)
19942238 Neuropeptide Y is negatively correlated with nonalcoholic fatty liver disease in obese adolescents.
19913525 The C allele of -399 T/C polymorphism in the promoter regions of NPY is an independent risk factor for ischemic stroke.
19913525 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19865784 These results suggest that genetic variation at the NPY locus may contribute to bone density, independently of body weight
19865784 Observational study of gene-disease association. (HuGE Navigator)
19854625 The present results point towards a possible influence of functional NPY gene variation on antidepressant treatment response in anxious depression, potentially conveyed by altered emotional processing.
19854625 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19846279 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19804960 NPY mRNA levels were not significantly lower in the gray matter of subjects with schizophrenia or schizoaffective disorder.
19699258 Data suggest that neuropeptide Y modulates steroid production through Y1 receptors in human adrenal H295R cells.
19620246 NPY3-35 is a new peptide generated by plasma kallikrein
19619519 Observational study of gene-disease association. (HuGE Navigator)
19587357 Meta-analysis of gene-disease association. (HuGE Navigator)
19566775 Genotypic distribution of the NPY1R gene showed a significant association with methamphetamine dependence and psychosis (P = 0.04), whereas the NPY gene had no significant association with them.
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19423065 a large amount of nerves are present around the blood vessels in the endometriosis samples, and a large number of these nerves are neuropeptide-Y sympathetic nerves.
19404163 result indicates that NPY do not contribute to a genetic susceptibility to schizophrenia
19367093 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19309436 observed that IL-1beta increases the release of NPY, norepinephrine & epinephrine from chromaffin cells; data suggest that IL-1beta, NPY, and nitric oxide (NO) may contribute to a regulatory loop between the immune and the adrenal systems
19289742 neuropeptide y is widely expressed in the nervous system and has been shown to have a role in numerous physiologic processes--{REVIEW}
19264362 Pro7 allele of preproNPY protected against depression among Swedes. Pro7 is not common, but was found to exert its protective effect also in an environment-induced vulnerable state.
19264362 Observational study of gene-disease association. (HuGE Navigator)
19245788 The current study investigates the effect of the NPY P7 allele in endothelial cells, where decreased nitric oxide production is a promoting factor to endothelial dysfunction.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19150389 No association between a functional polymorphism in the promoter region of the neuropeptide Y gene (-485C>T) and schizophrenia.
19150389 Observational study of gene-disease association. (HuGE Navigator)
19119412 NPY contributes to atherosclerosis pathogenesis.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18828811 Observational study of gene-disease association. (HuGE Navigator)
18815063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18715275 The neuropeptide Y (NPY) genotype is suggested to be involved in the individual differences in regulation of catecholamine secretion.
18715275 Observational study of gene-disease association. (HuGE Navigator)
18641693 NPY-mediated mitogenesis signals primarily via neuropeptide Y1 receptors activating Ca2+-dependent, growth-promoting pathways
18636124 Observational study of gene-disease association. (HuGE Navigator)
18499283 p.L7P polymorphism may be a strong independent risk factor for various metabolic and cardiovascular diseases (Review)
18461271 Results show that oxytocin modulates the NPY response to ghrelin, whereas it is unable to produce direct inhibitions of basal circulating NPY levels.
18423883 This study revealed that the GHRH perikarya formed intimate associations with NPY fiber varicosities and juxtapositions were found in the infundibular nucleus/median eminence where NPY fiber varicosities often covered surface area of the GHRH neurons.
18420205 The reduction in NPY in the anterior and posterior vaginal wall epithelium might be related to nerve damage or degeneration in patients with pelvic organ prolapse and stress urinary incontinence.
18385673 haplotype-driven NPY expression predicts brain responses to emotional and stress challenges and also inversely correlates with trait anxiety
18279562 The Leu7Pro polymorphism may be associated with dietary response to LDL-C concentration in overweight boys with a family history of early-onset CVD.
18279562 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18257117 Lower NPY expression level is significantly associated with more aggressive clinical behavior of prostate cancer
18241322 There is no significant association with neuropeptide Y gene and alcoholism following analysis of haplotype or single nucleotide polymorphism.
18241322 Observational study of gene-disease association. (HuGE Navigator)
18211417 NPY plasma level in patients with atopic dermatitis was significantly increased both during exacerbation and remission.
18055304 no significant relationship between the NPY gene nt 5671 C/T polymorphism and febrile seizure.
18055304 Observational study of gene-disease association. (HuGE Navigator)
18054939 NPY Pro7 substitution protects middle-aged men from coronary artery atherosclerosis and might decrease the risk of acute coronary events
18054939 Observational study of gene-disease association. (HuGE Navigator)
18043699 obesity may be a pivotal factor in multiplying the disease risk associated with the Leu7Pro polymorphism in preproNPY
18037100 Inverse relationships between neuropeptide Y (NPY) and biomarkers (bone and serum alkaline phosphatase) levels of bone turnover suggest that NPY may be implicated in low bone turnover in dialysis patients by a parathyroid-independent mechanism.
18031993 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17984244 Observational study of gene-disease association. (HuGE Navigator)
17984244 The Leu7Pro polymorphism of neuropeptide Y confers susceptibility to development of diabetic neuropathy in Swedish female type I diabetes patients.
17948870 Observational study of gene-disease association. (HuGE Navigator)
17702963 Observational study of gene-disease association. (HuGE Navigator)
17702963 remarkable haplotypic association suggested that the interaction between the 2 common sequence polymorphisms in NPY contributed to a great amount of phenotypic variability of ischemic stroke
17695723 neuropeptide Y has a role in prostate neoplasm growth through MAP kinase/ERK 1/2 activation [review]
17554476 Observational study of genotype prevalence. (HuGE Navigator)
17554476 Significant frequencies of the Pro7 allele of NPY are found in the majority of Indian populations studied.
17525122 Cocaine- and amphetamine-regulated transcript is expressed in NPY and agouti related protein neurons in the human hypothalamus.
17516289 Observational study of gene-disease association. (HuGE Navigator)
17516289 No impact of preproNPY genotype on mean NPY or hormone levels were detected in subjects with type 2 diabetes.
17366345 Observational study of gene-disease association. (HuGE Navigator)
17325259 Observational study of gene-disease association. (HuGE Navigator)
17305733 Observational study of gene-disease association. (HuGE Navigator)
17305733 Leu7Pro polymorphism in the signal peptide region of the human prepro-NPY is not a risk factor for exudative AMD.
17268419 Observational study of gene-disease association. (HuGE Navigator)
17268419 PreproNPY Pro7 allele is associated with an increased risk for type II diabetes with a higher insulin resistance among Pro7 carriers whereas low ghrelin concentrations in Pro7 carriers are possibly a consequence of high insulin levels.
17187020 this is the first demonstration of a ghrelin-NPY interaction in humans, which may suggest a possible mediation of ghrelin action by NPY in humans
17154253 NPY, via NPY Y5 and to a lesser extent via the Y1 receptors, exerts a stimulatory action on Ucn1 cells in the nonpreganglionic Edinger-Westphal nucleus.
17066479 -485 T, a novel polymorphism in the promoter region of the neuropeptide Y gene, most likely confers resistance but not susceptibility to schizophrenia.
16912140 Observational study of gene-disease association. (HuGE Navigator)
16785149 higher concentrations of neuropeptide Y in constitutional delay of puberty(CDP) girls may be responsible for CDP and reduced levels of insulin growth factor-I(IGF-I)
16568137 Observational study of gene-disease association. (HuGE Navigator)
16500360 Neuropeptide Y levels were significantly higher in normal cycling athletes, suggesting possibility of protective role of neuropeptide Y in maintenance of menstrual cycle in highly trained athletes.
16459651 Observational study of gene-disease association. (HuGE Navigator)
16390370 Observational study of gene-disease association. (HuGE Navigator)
16383010 This review underscores the need to understand how the functions of NPY are altered by the chronic neurodegenerative changes that occur in Alzheimer's, Parkinson's, and Huntington's disease.
16383009 In this review, NPY is a mediator and a marker of chronic stress in humans, including extreme trauma and posttraumatic stress disorder
16383001 This is a review of evidence in support of a potential role for NPY in heart failure progression and remodeling via actions on vascular and cardiomyocyte function exerted via multiple NPY receptors
16383000 This review defines NPY as an important sympathetic transmitter that clearly acts via intracerebral nerves as well to regulate local cerebral blood flow.
16382999 This review summarizes the evidence implicating peripheral and central NPY in the development and/or maintenance of hypertension or stress-induced hypertension in humans, and points out the definitive proof of the role of NPY that is still lacking.
16382997 This review discusses the dual role of NPY as modulator of sympathetic co-transmission; it facilitates vascular smooth muscle reactivity and modulates the presynaptic release of adenosine triphosphate (ATP) and noradrenaline.
16339211 Y1 receptor activation by neuropeptide Y regulates the growth of prostate cancer cells
16136022 Altered neuroregulation of the neuropeptides (leptin and NPY) secretion may contribute persistent amenorrhea after weight gain in anorectic patients with low initial body mass index
16135994 orexin A, NPY, leptin play an important role in the regulation of energy metabolism in humans; in obesity the activity of these peptides is disturbed.
15959845 Observational study of gene-disease association. (HuGE Navigator)
15959845 NPY polymorphisms might influence cholesterol metabolism, but might not act as major risk factor in Alzheimer's disease
15926114 Observational study of gene-disease association. (HuGE Navigator)
15926114 study provides the evidence that Leu7Pro polymorphism in the neuropeptide Y (NPY) gene is associated with impaired glucose tolerance (IGT) and type 2 diabetes in Swedish men
15897713 Observational study of gene-disease association. (HuGE Navigator)
15894681 Observational study of gene-disease association. (HuGE Navigator)
15850450 human umbilical-vein endothelial cells produce, store and respond to NPY, suggesting an autocrine regulatory role for NPY in the endothelium
15847953 Observational study of gene-disease association. (HuGE Navigator)
15847953 The T1128C polymorphism of the NPY gene is population specific and extremely low in a Chinese population.
15797951 Observational study of gene-disease association. (HuGE Navigator)
15797951 the Leu7Pro polymorphism of preproNPY is related to decreased level of basal sympathetic activity, decreased insulin secretion, and delayed ghrelin suppression during oral glucose tolerance test
15759545 Kidney transplantation does not normalize plasma NPY posttransplant. Transplanted kidney with good excretory functions and immunosupressive therapy are not essential factors involved in maintence of elevated NPY plasma level early posttransplant.
15736042 choroid contains abundant NPY and TH nerve fibers related to chroroidal vascular structures
15680469 Observational study of gene-disease association. (HuGE Navigator)
15680469 Results indicate that the neuropeptide Y signaling system is implicated in body weight regulation and suggest a new and unexpected functional role of a signal peptide.
15625769 results corroborate the involvement of neuropeptide Y in sexual maturation and its role in delayed puberty
15597110 Observational study of gene-disease association. (HuGE Navigator)
15485137 Number and size of neuropeptide Y positive cells were greater at birth and reached maximal values of 100-400 cells per 1 mm2 and 2-5 microm in diameter, respectively.
15364898 Our data support the hypothesis of epistatic interaction between ADRB2 and NPY in regulation of LDL levels in hypertensive subjects.
15336593 Observational study of gene-disease association. (HuGE Navigator)
15336593 The leucine 7/proline 7 polymorphism in the NPY signal gene may favorably affect femoral neck bone mineral density in postmenopausal women.
15201542 Observational study of gene-disease association. (HuGE Navigator)
15201542 the NPY T1128C polymorphism is an independent predictor for myocardial infarction and stroke in a Swedish hypertensive population.
15165988 NPY participates in sympathetically mediated cutaneous vasoconstriction in humans during whole body cooling.
15126561 Aging women is have increased NPY gene expression. Functional relationship between NPY and POMC neurons demonstrated in other species also exists in human. Increase in NPY mRNA in older women may be due to factors other than ovarian failure of menopause.
14751436 Proportional comparison of NPY neurons in four compartments, upper cortical layers, lower cortical layers, subcortical white matter and deep white matter, demonstrated differential distribution between schizophrenic brains and controls.
14747236 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14747236 Leu7Pro polymorphism may contribute to the genetic susceptibility to diabetic nephropathy and coronary disease in type 1 diabetic patients
14628185 Observational study of genotype prevalence. (HuGE Navigator)
12932169 Observational study of gene-disease association. (HuGE Navigator)
12878188 Analysis of a repressor region in the neuropeptide Y gene that binds Oct-1 and Pbx-1 in neurons.
12875921 a novel polymorphism in the promoter region of the neuropeptide Y gene is associated with schizophrenia in humans.
12843176 genetically determined changes in NPY levels lead to widespread consequences in the control of sympathoadrenal, metabolic, and hormonal balance in healthy subjects.
12818415 Proline 7 substitution in signal peptide of the NPY is associated with enhanced endothelial-dependent vasodilation.
12782203 hypothalamic neuropeptide Y in the phenotypic expression of hyperphagia in the fa/fa pups during the second postnatal week
12759898 Observational study of gene-disease association. (HuGE Navigator)
12759898 Leu7Pro polymorphism of the NPY gene associates with alterations in FFA metabolism but does not have an impact on insulin sensitivity, insulin secretion, or glucose metabolism
12689610 NPY affects the cortical sequelae of hunger and satiety regulation as reflected by cortical DC-potentials in man.
12646110 Observational study of genotype prevalence. (HuGE Navigator)
12544000 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
12544000 Neuropeptide Y Pro7 frequencies in the control populations were similar to the alcoholics, in Finns and Swedes, yielding no association with neuropeptide Y Pro7 frequency, in contrast with the Yale study.
12454738 Observational study of gene-disease association. (HuGE Navigator)
12215082 Observational study of gene-disease association. (HuGE Navigator)
12209475 a study of ligand-receptor interactions (review)
12187924 Autonomic neuropathy is associated with impaired pancreatic polypeptide and this peptide responses to insulin-induced hypoglycaemia in Type I diabetic patients.
12187394 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12081635 Observational study of genotype prevalence. (HuGE Navigator)
11932939 NPY regulates the CRH system of the human hypothalamus and some of the effects of NPY on metabolic, autonomic, and endocrine functions may be mediated through CRH
11914038 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11884208 Circulating NPY in fulminant hepatic failure does not seem to reflect cerebral blood flow.
11814620 Aging of human microvascular endothelial cells in vitro led to a loss of their mitogenic responses to NPY accompanied by a lack of NPY receptor mRNAs
11696660 Observational study of gene-disease association. (HuGE Navigator)
11689216 Observational study of gene-disease association. (HuGE Navigator)
11422604 Observational study of genotype prevalence. (HuGE Navigator)
11410744 Observational study of gene-disease association. (HuGE Navigator)
9756788 Neuropeptide Y has fungicidal, antimicrobial activity against Candida albicans.

AA Sequence

MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP      1 - 70
ETLISDLLMRESTENVPRTRLEDPAMW                                                71 - 97
//

Text Mined References (279)

PMID Year Title
26683132 2015 Expression of Neuropeptide Y and Its Relationship with Molecular and Morphological Changes in Human Pituitary Adenomas.
26621486 2016 Neuropeptide Y is a physiological substrate of fibroblast activation protein: Enzyme kinetics in blood plasma and expression of Y2R and Y5R in human liver cirrhosis and hepatocellular carcinoma.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26240981 2015 Comprehensive evaluation of the neuropeptide-Y gene variants in the risk of obesity: a case-control study and meta-analysis.
26220979 2015 Neuropeptide Y mitigates neuropathology and motor deficits in mouse models of Machado-Joseph disease.
26156739 2015 Neuropeptide Y genotype, central obesity, and abdominal fat distribution: the POUNDS LOST trial.
26111352 2015 Obesity, asthma prevalence and IL-4: Roles of inflammatory cytokines, adiponectin and neuropeptide Y.
26021463 2015 Assessment of both serum S-100B protein and neuropeptide-Y levels in childhood breath-holding spells.
26002416 2015 Immunohistochemical distribution of neuropeptide Y, peptide YY, pancreatic polypeptide-like immunoreactivity and their receptors in the epidermal skin of healthy women.
25924821 2015 Unwinding of the C-Terminal Residues of Neuropeptide Y is critical for Y? Receptor Binding and Activation.
25920420 2015 Neuropeptide Y levels are associated with nutritional status and cardiovascular events in adults with chronic kidney disease.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25798605 2015 Neuropeptide Y and ?-MSH circadian levels in two populations with low body weight: anorexia nervosa and constitutional thinness.
25714031 2015 High neuropeptide Y release associates with Ewing sarcoma bone dissemination - in vivo model of site-specific metastases.
25453484 2014 Low neuropeptide Y in cerebrospinal fluid in bipolar patients is associated with previous and prospective suicide attempts.
25427865 2014 Lack of an association between a functional polymorphism in the neuropeptide Y gene promoter and the presence of coronary artery disease in an Iranian population.
25387699 2015 Systemic levels of neuropeptide Y and dipeptidyl peptidase activity in patients with Ewing sarcoma--associations with tumor phenotype and survival.
25258030 2015 Neuropeptide Y is a minor autoantigen in newly diagnosed type 1 diabetes patients.
25256105 2014 Genome-wide exploration identifies sex-specific genetic effects of alleles upstream NPY to increase the risk of severe periodontitis in men.
25221996 2014 Association of neuropeptide Y (NPY), interleukin-1B (IL1B) genetic variants and correlation of IL1B transcript levels with vitiligo susceptibility.
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
25081719 2014 Association of polymorphisms in stress-related TNF? and NPY genes with the metabolic syndrome in Han and Hui ethnic groups.
25026432 2014 The effect of neuropeptide Y on cell survival and neurotrophin expression in in-vitro models of Alzheimer's disease.
24965867 2014 Distribution of peptidergic populations in the human dentate gyrus (somatostatin [SOM-28, SOM-12] and neuropeptide Y [NPY]) during postnatal development.
24897239 2015 Association of neuropeptide Y gene rs16147 polymorphism with metabolic syndrome in patients with documented coronary artery disease.
24858338 2014 Vascular neuropeptide Y contributes to atherosclerotic plaque progression and perivascular mast cell activation.
24779394 2014 NPY/Y? receptor-mediated vasoconstrictory and proliferative effects in pulmonary hypertension.
24757681 2014 Neuropeptide Y in the adult and fetal human pineal gland.
24709369 2014 Serum neuropeptide Y in accident survivors with depression or posttraumatic stress disorder.
24699455 2014 Neuropeptide Y induces potent migration of human immature dendritic cells and promotes a Th2 polarization.
24289328 2013 Aberrant methylation of NPY, PENK, and WIF1 as a promising marker for blood-based diagnosis of colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24213859 2014 Noradrenaline and neuropeptide Y contribute to initial, but not sustained, vasodilatation in response to local skin warming in humans.
24184719 2014 Emerging novel roles of neuropeptide Y in the retina: from neuromodulation to neuroprotection.
24121255 2014 Association of age at onset in Huntington disease with functional promoter variations in NPY and NPY2R.
24077326 2014 The relationship of plasma neuropeptide Y levels with coronary collateral development.
24012636 2013 Contributions of endothelial nitric oxide synthase, noradrenaline, and neuropeptide Y to local warming-induced cutaneous vasodilatation in men.
23994577 2013 Therapeutic concentrations of valproate but not amitriptyline increase neuropeptide Y (NPY) expression in the human SH-SY5Y neuroblastoma cell line.
23864142 2013 Levels of dipeptidyl peptidase IV/CD26 substrates neuropeptide Y and vasoactive intestinal peptide in rheumatoid arthritis patients.
23838112 2013 Expressions of neuropeptide Y and Y1 receptor in subcutaneous and visceral fat tissues in normal weight and obese humans and their correlations with clinical parameters and peripheral metabolic factors.
23831408 2013 Association of weight regain with specific methylation levels in the NPY and POMC promoters in leukocytes of obese men: a translational study.
23652383 2013 Functional polymorphism in the neuropeptide Y gene promoter (rs16147) is associated with serum leptin levels and waist-hip ratio in women.
23624317 2013 Influence of variants in the NPY gene on obesity and metabolic syndrome features in Spanish children.
23599389 2013 Defects in the striatal neuropeptide Y system in X-linked dystonia-parkinsonism.
23482625 2014 Interaction of neuropeptide Y genotype and childhood emotional maltreatment on brain activity during emotional processing.
23468908 2013 A neuropeptide Y variant (rs16139) associated with major depressive disorder in replicate samples from Chinese Han population.
23459936 2013 Exploring the genetic basis of chronic periodontitis: a genome-wide association study.
23457218 2013 Platelet neuropeptide Y is critical for ischemic revascularization in mice.
23407263 2013 Neuropeptide Y genes and suicidal behaviour among schizophrenic patients.
23403409 2013 Relationship of plasma neuropeptide Y with angiographic, electrocardiographic and coronary physiology indices of reperfusion during ST elevation myocardial infarction.
23390522 2013 Characterization of transcriptional changes in ERG rearrangement-positive prostate cancer identifies the regulation of metabolic sensors such as neuropeptide Y.
23277265 2013 Association of a functional polymorphism in neuropeptide Y with antipsychotic-induced weight gain in schizophrenia patients.
23122776 2012 Neuropeptide Y polymorphism increases the risk for asthma in overweight subjects; protection from atherosclerosis in asthmatic subjects--the cardiovascular risk in young Finns study.
23116540 2012 Multifaces of neuropeptide Y in the brain--neuroprotection, neurogenesis and neuroinflammation.
23110814 2012 Neuronal circuits involving neuropeptide Y in hypothalamic arcuate nucleus-mediated feeding regulation.
23107365 2012 Arcuate NPY neurons sense and integrate peripheral metabolic signals to control feeding.
23083763 2012 Dorsomedial hypothalamic NPY and energy balance control.
23074243 2012 Central nervous system neuropeptide Y signaling via the Y1 receptor partially dissociates feeding behavior from lipoprotein metabolism in lean rats.
23021333 2012 Neuropeptide Y (NPY): genetic variation in the human promoter alters glucocorticoid signaling, yielding increased NPY secretion and stress responses.
22985695 2012 Cerebrospinal fluid neuropeptide Y-like immunoreactivity correlates with impulsive aggression in human subjects.
22979996 2012 Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis.
22966009 2012 Neuropeptide Y promoter polymorphism modifies effects of a weight-loss diet on 2-year changes of blood pressure: the preventing overweight using novel dietary strategies trial.
22941950 2012 Increasing association between a neuropeptide Y promoter polymorphism and body mass index during the course of development.
22849656 2013 NT, NPY and PGP 9.5 presence in myomeytrium and in fibroid pseudocapsule and their possible impact on muscular physiology.
22808091 2012 NPY and VGF immunoreactivity increased in the arcuate nucleus, but decreased in the nucleus of the Tractus Solitarius, of type-II diabetic patients.
22632858 2012 The role of NPY and ghrelin in anorexia nervosa.
22584873 2012 Genetic variation in the neuropeptide Y gene promoter is associated with increased risk of tobacco smoking.
22492775 2012 AgRP and NPY expression in the human hypothalamic infundibular nucleus correlate with body mass index, whereas changes in ?MSH are related to type 2 diabetes.
22393040 2012 Human cathepsin V protease participates in production of enkephalin and NPY neuropeptide neurotransmitters.
22328461 2012 Support for involvement of glutamate decarboxylase 1 and neuropeptide Y in anxiety susceptibility.
22308535 2013 Neuropeptide Y Leu7Pro polymorphism associated with the metabolic syndrome and its features in patients with coronary artery disease.
22289186 2012 High frequency of Neuropeptide Y Leu7Pro polymorphism in an Iranian population and its association with coronary artery disease.
22143932 2012 Neuropeptide Y innervation in the vaginal mucosa among patients with pelvic organ prolapse.
21937627 2011 Polymorphisms in the neuropeptide Y gene and the risk of obesity: findings from two prospective cohorts.
21917383 2012 Genetic modulation of plasma NPY stress response is suppressed in substance abuse: association with clinical outcomes.
21898706 2012 Proinflammatory and "resiliency" proteins in the CSF of patients with major depression.
21849543 2011 Fasting and 17?-estradiol differentially modulate the M-current in neuropeptide Y neurons.
21796371 2011 Serum NPY and BNDF response to a behavioral stressor in alcohol-dependent and healthy control participants.
21746772 2011 Inflammatory effects of blood leukocytes: association with vascular function in neuropeptide Y proline 7-genotyped type 2 diabetes patients.
21640760 2011 Inhibitory effect of somatostatin on the NPY response to insulin-induced hypoglycemia and the role of endogenous opioids.
21626172 2011 The possible role of neuropeptide Y after spontaneous subarachnoid hemorrhage.
21468772 2011 Of mice and men: neuropeptide Y and its receptors are associated with atherosclerotic lesion burden and vulnerability.
21426768 2011 [Expression of protein gene product 9.5, vasoactive intestinal peptide and neuropeptide Y in the mucosa of the neovagina after sigmoid colon vaginoplasty].
21396710 2011 A putative morphological substrate of the catecholamine-influenced neuropeptide Y (NPY) release in the human hypothalamus.
21346312 2011 Neuroprotective effect of neuropeptide Y against ?-amyloid 25-35 toxicity in SH-SY5Y neuroblastoma cells is associated with increased neurotrophin production.
21314817 2011 Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-?.
21303710 2011 The 1258 G>A polymorphism in the neuropeptide Y gene is associated with greater alcohol consumption in a Mediterranean population.
21273004 2011 An interaction between a neuropeptide Y gene polymorphism and early adversity modulates endocrine stress responses.
21190576 2010 Plasma neuropeptide Y: a biomarker for symptom severity in chronic fatigue syndrome.
21145602 2011 Neuropeptide Y-induced coronary microvascular dysfunction: a significant contributor to the adverse outcomes in stress cardiomyopathy?
21047193 2011 No association of the neuropeptide Y (Leu7Pro) and ghrelin gene (Arg51Gln, Leu72Met, Gln90Leu) single nucleotide polymorphisms with eating disorders.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20945961 2011 Changes of plasma obestatin, ghrelin and NPY in anorexia and bulimia nervosa patients before and after a high-carbohydrate breakfast.
20846339 2010 Morphology, molecular phenotypes and distribution of neurons in developing human corpus callosum.
20832114 2010 Plasma neuropeptide Y levels differ in distinct diabetic conditions.
20823688 2010 Expression of neuropeptide Y, omentin and visfatin in visceral and subcutaneous adipose tissues in humans: relation to endocrine and clinical parameters.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20691708 2010 The Leu7Pro polymorphism of the signal peptide of neuropeptide Y (NPY) gene is associated with increased levels of inflammatory markers preceding vascular complications in patients with type 2 diabetes.
20676138 2010 Neuropeptide Y and its Y2 receptor: potential targets in neuroblastoma therapy.
20675276 2010 Changes in vasoactive intestinal peptide, pituitary adenylate cyclase-activating polypeptide and neuropeptide Y-ergic structures of the enteric nervous system in the carcinoma of the human large intestine.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20648632 2010 Human NPY promoter variation rs16147:T>C as a moderator of prefrontal NPY gene expression and negative affect.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20543711 2010 Neuropeptide Y receptor Y2 gene polymorphism interacts with plasma neuropeptide Y levels in predicting left ventricular hypertrophy in dialysis patients.
20531438 2010 Neuropeptide Y gene polymorphisms are not associated with obesity in a South Indian population.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20459474 2011 Can we predict top-level sports performance in power vs endurance events? A genetic approach.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20435026 2010 Age and sex dependent genetic effects of neuropeptide Y promoter polymorphism on susceptibility to ischemic stroke in Koreans.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20308990 2011 Genome-wide copy number variation analysis in attention-deficit/hyperactivity disorder: association with neuropeptide Y gene dosage in an extended pedigree.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20173430 Frequencies of polymorphisms in cytokines, neurotransmitters and adrenergic receptors in patients with complex regional pain syndrome type I after distal radial fracture.
20164781 2010 The role of nutritional profile in the orexigenic neuropeptide secretion in nonalcoholic fatty liver disease obese adolescents.
20138117 2010 Insulin and NPY pathways and the control of GnRH function and puberty onset.
20037921 2010 NPY moderates the relation between hurricane exposure and generalized anxiety disorder in an epidemiologic sample of hurricane-exposed adults.
20033074 2010 Neuropeptide Y gene functional polymorphism influences susceptibility to hypertension in Indian population.
19942238 2010 Negative correlation between neuropeptide Y/agouti-related protein concentration and adiponectinemia in nonalcoholic fatty liver disease obese adolescents submitted to a long-term interdisciplinary therapy.
19913525 2010 Neuropeptide Y polymorphisms and ischemic stroke in Chinese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19865784 2009 Molecular variation in neuropeptide Y and bone mineral density among men of African ancestry.
19854625 2010 Neuropeptide Y (NPY) gene: Impact on emotional processing and treatment response in anxious depression.
19846279 2009 Acetyl-coenzyme A carboxylase alpha gene variations may be associated with the direct effects of some antipsychotics on triglyceride levels.
19804960 2009 NPY mRNA expression in the prefrontal cortex: Selective reduction in the superficial white matter of subjects with schizoaffective disorder.
19699258 2010 Neuropeptide Y modulates steroid production of human adrenal H295R cells through Y1 receptors.
19620246 2009 Kinetic study of neuropeptide Y (NPY) proteolysis in blood and identification of NPY3-35: a new peptide generated by plasma kallikrein.
19619519 2009 Association of the C-399T promoter polymorphism of neuropeptide Y with susceptibility to ischemic stroke.
19587357 2009 A systematic meta-analysis of genetic association studies for diabetic retinopathy.
19566775 2009 Association between neuropeptide Y gene and its receptor Y1 gene and methamphetamine dependence.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19423065 Comparative study of the neuropeptide-Y sympathetic nerves in endometriotic involved and noninvolved sacrouterine ligaments in women with pelvic endometriosis.
19404163 2009 Lack of association between polymorphisms of neuropeptide Y and schizophrenia in Korean population.
19367093 2009 Association study between candidate genes and obesity-related phenotypes using a sample of lumberjacks.
19309436 2009 Regulation of catecholamine release and tyrosine hydroxylase in human adrenal chromaffin cells by interleukin-1beta: role of neuropeptide Y and nitric oxide.
19289742 2009 Neuropeptide Y: its multiple effects in the CNS and potential clinical significance.
19264362 2009 PreproNPY Pro7 protects against depression despite exposure to environmental risk factors.
19245788 2009 The role of non-synonymous NPY gene polymorphism in the nitric oxide production in HUVECs.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19150389 2009 No association between a functional polymorphism in the promoter region of the neuropeptide Y gene (-485C>T) and schizophrenia.
19119412 2009 Neuropeptide Y gene polymorphisms confer risk of early-onset atherosclerosis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18828811 2008 Neuropeptide Y receptor genes are associated with alcohol dependence, alcohol withdrawal phenotypes, and cocaine dependence.
18815063 2008 Genetic variation may influence obesity only under conditions of diet: analysis of three candidate genes.
18715275 2008 Effects of functional polymorphisms related to catecholaminergic systems on changes in blood catecholamine and cardiovascular measures after alcohol ingestion in the Japanese population.
18641693 2008 Interactions of multiple signaling pathways in neuropeptide Y-mediated bimodal vascular smooth muscle cell growth.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18603306 2008 Antimicrobial activity of neuropeptides against a range of micro-organisms from skin, oral, respiratory and gastrointestinal tract sites.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18499283 2008 NPY L7P polymorphism and metabolic diseases.
18461271 2008 Oxytocin inhibits the stimulatory effect of ghrelin on circulating neuropeptide Y levels in humans.
18423883 2008 Associations between the human growth hormone-releasing hormone- and neuropeptide-Y-immunoreactive systems in the human diencephalon: a possible morphological substrate of the impact of stress on growth.
18420205 2008 Neuropeptide Y expression in vaginal epithelium of women with pelvic organ prolapse and stress urinary incontinence.
18385673 2008 Genetic variation in human NPY expression affects stress response and emotion.
18279562 2008 Leucine 7 to proline 7 polymorphism in the neuropeptide Y gene and changes in serum lipids during a family-based counselling intervention among school-aged children with a family history of CVD.
18257117 2007 Quantitative analysis of a panel of gene expression in prostate cancer--with emphasis on NPY expression analysis.
18241322 2008 Analysis of single nucleotide polymorphisms and haplotypes in the neuropeptide Y gene: no evidence for association with alcoholism in a German population sample.
18211417 2008 The role of selected neuropeptides in pathogenesis of atopic dermatitis.
18055304 2007 Neuropeptide Y gene polymorphism and plasma neuropeptide Y level in febrile seizure patients in Taiwan.
18054939 2008 Neuropeptide Y signal peptide Pro7 substitution protects against coronary artery atherosclerosis: the Helsinki Sudden Death Study.
18043699 2009 Neuropeptide Y polymorphism significantly magnifies diabetes and cardiovascular disease risk in obesity: the Hoorn Study.
18037100 2007 Neuropeptide Y and markers of osteoblast activity in dialysis patients: a cross-sectional study.
18031993 2008 Exploring genetic variations that may be associated with the direct effects of some antipsychotics on lipid levels.
17984244 2007 Distribution of neuropeptide Y Leu7Pro polymorphism in patients with type 1 diabetes and diabetic nephropathy among Swedish and American populations.
17948870 2008 Chromosome 4q31-34 panic disorder risk locus: association of neuropeptide Y Y5 receptor variants.
17702963 2007 An interactive association of common sequence variants in the neuropeptide Y gene with susceptibility to ischemic stroke.
17695723 2007 Modulatory actions of neuropeptide Y on prostate cancer growth: role of MAP kinase/ERK 1/2 activation.
17554476 2007 Allelic variation in the NPY gene in 14 Indian populations.
17525122 2007 Cocaine- and amphetamine-regulated transcript (CART) is colocalized with the orexigenic neuropeptide Y and agouti-related protein and absent from the anorexigenic alpha-melanocyte-stimulating hormone neurons in the infundibular nucleus of the human hypothalamus.
17516289 2007 Impact of the Leu7Pro polymorphism of preproNPY on diurnal NPY and hormone secretion in type 2 diabetes.
17366345 2007 Potential genetic variants in schizophrenia: a Bayesian analysis.
17325259 2007 Association studies of BMI and type 2 diabetes in the neuropeptide Y pathway: a possible role for NPY2R as a candidate gene for type 2 diabetes in men.
17305733 2007 Leucine 7-proline 7 polymorphism in the signal peptide of neuropeptide Y is not a risk factor for exudative age-related macular degeneration.
17268419 2007 Leu7Pro polymorphism of PreproNPY associated with an increased risk for type II diabetes in middle-aged subjects.
17187020 2006 Effects of ghrelin on circulating neuropeptide Y levels in humans.
17154253 2007 Neuropeptide Y activates urocortin 1 neurons in the nonpreganglionic Edinger-Westphal nucleus.
17066479 2007 A resistance gene in disguise for schizophrenia?
16912140 2006 Nutrient intake, weight, and Leu7Pro polymorphism in prepro-neuropeptide Y in children.
16785149 2006 Body composition and concentrations of leptin, neuropeptide Y, beta-endorphin, growth hormone, insulin-like growth factor-I and insulin at menarche in girls with constitutional delay of puberty.
16568137 2006 Polymorphisms in the NPY and AGRP genes and body fatness in Dutch adults.
16500360 2006 Different plasma neuropeptide Y concentrations in women athletes with and without menstrual cyclicity.
16459651 2005 [Association study between NPY and YWHAH gene polymorphisms and schizophrenia].
16390370 2006 No association between the -399 C > T polymorphism of the neuropeptide Y gene and schizophrenia, unipolar depression or panic disorder in a Danish population.
16383010 2006 NPY and chronic neurodegenerative disease.
16383009 2006 NPY and extreme stress: lessons learned from posttraumatic stress disorder.
16383001 2006 Neuropeptide Y and the heart: implication for myocardial infarction and heart failure.
16383000 2006 Neuropeptide Y and the cerebral circulation.
16382999 2006 Neuropeptide Y and sympathetic control of vascular tone in hypertension.
16382997 2006 Modulator role of neuropeptide Y in human vascular sympathetic neuroeffector junctions.
16339211 2006 Activation of the Y1 receptor by neuropeptide Y regulates the growth of prostate cancer cells.
16136022 2005 Prospective evaluation of leptin and neuropeptide Y (NPY) serum levels in girls with anorexia nervosa.
16135994 2005 Plasma orexin A, orexin B, leptin, neuropeptide Y (NPY) and insulin in obese women.
15959845 2006 Polymorphism in neuropeptide Y influences CSF cholesterol levels but is no major risk factor of Alzheimer's disease.
15926114 2005 Leu7Pro polymorphism in the neuropeptide Y (NPY) gene is associated with impaired glucose tolerance and type 2 diabetes in Swedish men.
15897713 2005 A novel single nucleotide polymorphism of the neuropeptide Y (NPY) gene associated with alcohol dependence.
15894681 2005 Polymorphisms in ghrelin and neuropeptide Y genes are associated with non-Hodgkin lymphoma.
15850450 2005 Neuropeptide Y expression, localization and cellular transducing effects in HUVEC.
15847953 The T1128C polymorphism of neuropeptide Y gene in a chinese population.
15797951 2005 The Leu7Pro polymorphism of preproNPY is associated with decreased insulin secretion, delayed ghrelin suppression, and increased cardiovascular responsiveness to norepinephrine during oral glucose tolerance test.
15759545 2004 Plasma neuropeptide Y concentration in kidney transplant patients during the early posttransplant period.
15736042 2005 NPY and TH innervation in human choroidal whole-mounts.
15680469 2005 Human neuropeptide Y signal peptide gain-of-function polymorphism is associated with increased body mass index: possible mode of function.
15625769 2004 Is neuropeptide Y responsible for constitutional delay of puberty in girls? A preliminary report.
15597110 2005 Melanocortin-4 receptor gene and physical activity in the Québec Family Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485137 2004 Distribution of neuropeptide Y-immunoreactive neurons in the human brainstem, cerebellum, and cortex during development.
15364898 2004 Epistatic interaction between beta2-adrenergic receptor and neuropeptide Y genes influences LDL-cholesterol in hypertension.
15336593 2004 Leucine7 to proline7 polymorphism in prepro-NPY gene and femoral neck bone mineral density in postmenopausal women.
15201542 2004 Association analysis of the polymorphism T1128C in the signal peptide of neuropeptide Y in a Swedish hypertensive population.
15165988 2004 Neuropeptide Y antagonism reduces reflex cutaneous vasoconstriction in humans.
15126561 2004 Neuropeptide Y gene expression is increased in the hypothalamus of older women.
14751436 2004 Distribution of neuropeptide Y interneurons in the dorsal prefrontal cortex of schizophrenia.
14747236 2004 Leucine 7 to proline 7 polymorphism in the preproneuropeptide Y is associated with proteinuria, coronary heart disease, and glycemic control in type 1 diabetic patients.
14628185 2003 Distribution of the NPY 1128C allele frequency in different populations.
12932169 2003 Leucine 7 to proline 7 polymorphism of the preproneuropeptide Y gene is not associated with restenosis after coronary stenting.
12878188 2003 Analysis of a repressor region in the human neuropeptide Y gene that binds Oct-1 and Pbx-1 in GT1-7 neurons.
12875921 2003 Association between a novel polymorphism in the promoter region of the neuropeptide Y gene and schizophrenia in humans.
12853948 2003 The DNA sequence of human chromosome 7.
12843176 2003 Changes in diurnal sympathoadrenal balance and pituitary hormone secretion in subjects with Leu7Pro polymorphism in the prepro-neuropeptide Y.
12818415 2003 Enhanced endothelium-dependent vasodilation in subjects with Proline7 substitution in the signal peptide of neuropeptide Y.
12782203 2003 Decreased hypothalamic concentration of neuropeptide Y correlates with onset of hyperphagia in fa/fa rats on postnatal day 12.
12759898 2003 The Leu7Pro polymorphism of the neuropeptide Y gene regulates free fatty acid metabolism.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12689610 2003 NPY attenuates positive cortical DC-potential shift upon food intake in man.
12663466 2003 Ghrelin directly interacts with neuropeptide-Y-containing neurons in the rat arcuate nucleus: Ca2+ signaling via protein kinase A and N-type channel-dependent mechanisms and cross-talk with leptin and orexin.
12646110 2003 [Low prevalence of the Leu7/Pro polymorphism in the signal peptide of preproneuropeptide Y in the Spanish Mediterranean population].
12609745 2003 Characterization of the NPGP receptor and identification of a novel short mRNA isoform in human hypothalamus.
12544000 2003 NPY Leu7Pro and alcohol dependence in Finnish and Swedish populations.
12479530 2002 Effect of lipid infusion on plasma leptin and neuropeptide Y levels in women.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454738 2002 Severity of alcohol withdrawal symptoms and the T1128C polymorphism of the neuropeptide Y gene.
12215082 2002 A functional neuropeptide Y Leu7Pro polymorphism associated with alcohol dependence in a large population sample from the United States.
12209475 2001 Biophysical methods to study ligand-receptor interactions of neuropeptide Y.
12187924 2002 Autonomic neuropathy is associated with impaired pancreatic polypeptide and neuropeptide Y responses to insulin-induced hypoglycaemia in Type I diabetic patients.
12187394 2002 Association analysis of genes involved in the leptin-signaling pathway with obesity in Brazil.
12106685 2002 Interactions of neuropeptide Y, hypocretin-I (orexin A) and melanin-concentrating hormone on feeding in rats.
12081635 2002 The single nucleotide polymorphism T1128C in the signal peptide of neuropeptide Y (NPY) was not identified in a Korean population.
12034130 2002 The neurocircuitry and receptor subtypes mediating anxiolytic-like effects of neuropeptide Y.
12015205 2002 Evidence for an interaction between neuropeptide Y and the melanocortin-4 receptor on feeding in the rat.
12007534 2002 Neuropeptide Y receptors as targets for anti-obesity drug development: perspective and current status.
11932939 2002 Corticotropin-releasing hormone-synthesizing neurons of the human hypothalamus receive neuropeptide Y-immunoreactive innervation from neurons residing primarily outside the infundibular nucleus.
11914038 2002 Association of leucine 7 to proline 7 polymorphism in the preproneuropeptide Y with serum lipids in patients with coronary heart disease.
11884208 Circulating levels of neuropeptides (CGRP, VIP, NPY) in patients with fulminant hepatic failure.
11814620 2002 Neuropeptide Y-induced angiogenesis in aging.
11696660 2001 Association of neuropeptide y polymorphism with the occurrence of type 1 and type 2 alcoholism.
11689216 2001 Leucine7 to proline7 polymorphism in the preproneuropeptide Y is associated with the progression of carotid atherosclerosis, blood pressure and serum lipids in Finnish men.
11422604 2001 A leucine(7)-to-proline(7) polymorphism in the signal peptide of neuropeptide Y was not identified in the Japanese population.
11410744 2001 Polymorphism of the neuropeptide Y gene: an association study with alcohol withdrawal.
11325787 2001 Agonist and antagonist activities on human NPFF(2) receptors of the NPY ligands GR231118 and BIBP3226.
11278902 2001 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity.
11196643 2001 A role for ghrelin in the central regulation of feeding.
10770181 2000 Leucine 7 to proline 7 polymorphism in the preproneuropeptide Y is associated with birth weight and serum triglyceride concentration in preschool aged children.
10698177 2000 Role of the Y1 receptor in the regulation of neuropeptide Y-mediated feeding: comparison of wild-type, Y1 receptor-deficient, and Y5 receptor-deficient mice.
10561544 1999 Helical structure and self-association in a 13 residue neuropeptide Y Y2 receptor agonist: relationship to biological activity.
10557353 1999 Role of the Y5 neuropeptide Y receptor in limbic seizures.
10488139 1999 Y receptor-mediated induction of CD63 transcripts, a tetraspanin determined to be necessary for differentiation of the intestinal epithelial cell line, hBRIE 380i cells.
9845072 1998 Ethanol consumption and resistance are inversely related to neuropeptide Y levels.
9756788 1998 Enhancement of antimicrobial activity of neuropeptide Y by N-terminal truncation.
9067840 1997 Laminar distribution of neuropeptide Y-immunoreactive neurons in human prefrontal cortex during development.
9008359 1996 Solution structure of human neuropeptide Y.
9001438 1995 Neuropeptide Y receptor subtypes.
8421707 1993 Expression of the human neuropeptide tyrosine Y1 receptor.
8132547 1994 A pertussis toxin-insensitive calcium influx mediated by neuropeptide Y2 receptors in a human neuroblastoma cell line.
7782078 1995 Assignment of the human neuropeptide Y gene to chromosome 7p15.1 by nonisotopic in situ hybridization.
7559383 1995 Cloning and functional expression of a cDNA encoding a human type 2 neuropeptide Y receptor.
6589611 1984 Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine.
3839058 1985 Presence of the predicted C-flanking peptide of neuropeptide Y (CPON) in tissue extracts.
3753985 1986 Genes encoding pancreatic polypeptide and neuropeptide Y are on human chromosomes 17 and 7.
2444979 1987 Localization of neuropeptide Y mRNA in neurons of human cerebral cortex by means of in situ hybridization with a complementary RNA probe.
2427515 1986 Characterization, sequence, and expression of the cloned human neuropeptide Y gene.
1425680 1992 Solution conformation of human neuropeptide Y by 1H nuclear magnetic resonance and restrained molecular dynamics.
1321422 1992 Cloned human neuropeptide Y receptor couples to two different second messenger systems.