Property Summary

NCBI Gene PubMed Count 12
PubMed Score 206.10
PubTator Score 93.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 3.7e-03
ependymoma -1.400 9.1e-03
psoriasis 1.300 2.5e-04
glioblastoma -1.300 3.4e-04
oligodendroglioma -1.300 2.5e-18
osteosarcoma 1.550 1.1e-06
medulloblastoma -1.600 1.0e-07
atypical teratoid / rhabdoid tumor -1.400 2.6e-05
medulloblastoma, large-cell -2.000 4.5e-05
primitive neuroectodermal tumor -1.200 6.5e-06
lung cancer -1.100 4.0e-03
adult high grade glioma -1.100 1.1e-03
Pick disease -1.100 2.3e-02
ovarian cancer -2.000 3.6e-04
dermatomyositis 1.700 3.9e-04

Gene RIF (4)

PMID Text
25040546 correct synaptic membrane protein localization, neuronal energy supply, expression of LTP and LTD, animal and human behaviour, and pathophysiology and disease--{review}
24514566 This study showed that Single nucleotide polymorphism in the neuroplastin locus associates with cortical thickness and intellectual ability in adolescents.
17196182 In human brain np65 is prominently present in cerebellum while np55 is the predominant isoform in mouse and rat cerebellum.
17123723 NPTN may be involved in genetic susceptibility to schizophrenia.

AA Sequence

MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVN      1 - 70
RAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLRQNPSITWIRAQA     71 - 140
TISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRA    141 - 210
EDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPM    211 - 280
DIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEI    281 - 350
IILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN                          351 - 398
//

Text Mined References (16)

PMID Year Title
25040546 2014 The Neuroplastin adhesion molecules: key regulators of neuronal plasticity and synaptic function.
24514566 2015 Single nucleotide polymorphism in the neuroplastin locus associates with cortical thickness and intellectual ability in adolescents.
21269460 2011 Initial characterization of the human central proteome.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17196182 2007 The immunolocalization of the synaptic glycoprotein neuroplastin differs substantially between the human and the rodent brain.
17123723 2007 Association study of putative promoter polymorphisms in the neuroplastin gene and schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8995369 1997 Synaptic membrane glycoproteins gp65 and gp55 are new members of the immunoglobulin superfamily.
8619474 1996 A "double adaptor" method for improved shotgun library construction.